RAP1GAP Antibody


Western Blot: RAP1GAP Antibody [NBP1-53072] - Human 721_B, Antibody Dilution: 1.0 ug/ml RAP1GAP is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: RAP1GAP Antibody [NBP1-53072] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.
SDS-Page: RAP1GAP Antibody [NBP1-53072] - Human Hela, Antibody Dilution: 1.0 ug/ml RAP1GAP is supported by BioGPS gene expression data to be expressed in HeLa.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

RAP1GAP Antibody Summary

Synthetic peptides corresponding to RAP1GAP(RAP1 GTPase activating protein) The peptide sequence was selected from the middle region of RAP1GAP. Peptide sequence IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against RAP1GAP and was validated on Western blot.
Theoretical MW
73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAP1GAP Antibody

  • GTPase activating protein 1
  • RAP1 GTPase activating protein


RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC

Publications for RAP1GAP Antibody (NBP1-53072) (0)

There are no publications for RAP1GAP Antibody (NBP1-53072).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAP1GAP Antibody (NBP1-53072) (0)

There are no reviews for RAP1GAP Antibody (NBP1-53072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAP1GAP Antibody (NBP1-53072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RAP1GAP Products

Bioinformatics Tool for RAP1GAP Antibody (NBP1-53072)

Discover related pathways, diseases and genes to RAP1GAP Antibody (NBP1-53072). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAP1GAP Antibody (NBP1-53072)

Discover more about diseases related to RAP1GAP Antibody (NBP1-53072).

Pathways for RAP1GAP Antibody (NBP1-53072)

View related products by pathway.

PTMs for RAP1GAP Antibody (NBP1-53072)

Learn more about PTMs related to RAP1GAP Antibody (NBP1-53072).

Research Areas for RAP1GAP Antibody (NBP1-53072)

Find related products by research area.

Blogs on RAP1GAP

There are no specific blogs for RAP1GAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAP1GAP Antibody and receive a gift card or discount.


Gene Symbol RAP1GAP