RALBP1 Antibody (5C10W9)

Immunohistochemistry: RALBP1 Antibody (5C10W9) [NBP3-33554] - Immunohistochemistry analysis of RALBP1 in paraffin-embedded rat colon tissue using RALBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RALBP1 Antibody (5C10W9) [NBP3-33554] - Immunohistochemistry analysis of RALBP1 in paraffin-embedded mouse brain tissue using RALBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RALBP1 Antibody (5C10W9) [NBP3-33554] - Immunohistochemistry analysis of RALBP1 in paraffin-embedded mouse testis tissue using RALBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RALBP1 Antibody (5C10W9) [NBP3-33554] - Immunohistochemistry analysis of RALBP1 in paraffin-embedded human colon carcinoma tissue using RALBP1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: RALBP1 Antibody (5C10W9) [NBP3-33554] - Immunofluorescence analysis of U-2 OS cells using RALBP1 Rabbit mAb (A9701) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: ELISA, ICC/IF, IHC
• Clone: 5C10W9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RALBP1 Antibody (5C10W9) Summary

• Description: Novus Biologicals Rabbit RALBP1 Antibody (5C10W9) (NBP3-33554) is a monoclonal antibody validated for use in IHC, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human RALBP1 (Q15311).
  
  Sequence:
  RTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RALBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Theoretical MW: 76 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RALBP1 Antibody (5C10W9)

• Dinitrophenyl S-glutathione ATPase
• ralA binding protein 1
• ralA-binding protein 1,76 kDa Ral-interacting protein
• RalBP1
• Ral-interacting protein 1
• RIP
• RIP1
• RLIP1
• RLIP76DNP-SG ATPase

Background

The receptor interacting protein kinase 1 (RIP1) is essential for the activation of nuclear factor kappaB (NF-kappaB) by tumor necrosis factor alpha (TNFalpha). RIP1 can be polyubiquitinated at Lys 377, which is required for the activation of IkappaB kinase (IKK) and NF-kappaB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RALBP1