RAI14 Antibody

Images

 
Independent Antibodies: Western Blot: RAI14 Antibody [NBP1-94076] - Analysis using Anti-RAI14 antibody NBP1-94076 (A) shows similar pattern to independent antibody NBP1-94075 (B).
Immunocytochemistry/ Immunofluorescence: RAI14 Antibody [NBP1-94076] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RAI14 Antibody [NBP1-94076] - Staining of human placenta shows strong membrane and cytoplasmic positivity in trophoblastic cells.
Orthogonal Strategies: Western Blot: RAI14 Antibody [NBP1-94076] - Western blot analysis in human cell lines U2OS and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAI14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KAAMTDAMVPRSSYEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQEVNELLQKFQQAQEELAEMKRYAE
Specificity
Specificity of human RAI14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAI14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAI14 Antibody

  • retinoic acid induced 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF5928
Species: Hu
Applications: WB, IHC, ICC
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00827
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-02136
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055176-P01
Species: Hu
NB100-790
Species: Hu, Mu, Po, Ba
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA, IF
NB100-487
Species: Hu, Mu
Applications: WB, IP
NBP1-97491
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NBP2-03367
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83215
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50113
Species: Hu
Applications: WB, ICC/IF, IHC, IP
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS, KO
NBP1-94076
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RAI14 Antibody (NBP1-94076) (0)

There are no publications for RAI14 Antibody (NBP1-94076).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAI14 Antibody (NBP1-94076) (0)

There are no reviews for RAI14 Antibody (NBP1-94076). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAI14 Antibody (NBP1-94076) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAI14 Products

Array NBP1-94076

Bioinformatics Tool for RAI14 Antibody (NBP1-94076)

Discover related pathways, diseases and genes to RAI14 Antibody (NBP1-94076). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAI14 Antibody (NBP1-94076)

Discover more about diseases related to RAI14 Antibody (NBP1-94076).
 

Pathways for RAI14 Antibody (NBP1-94076)

View related products by pathway.

Blogs on RAI14

There are no specific blogs for RAI14, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAI14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAI14
Novus 100% Guarantee