![Western Blot: RAI14 Antibody [NBP1-94076] - Analysis using Anti-RAI14 antibody NBP1-94076 (A) shows similar pattern to independent antibody NBP1-94075 (B).](http://images.novusbio.com/fullsize/RAI14-Antibody-Western-Blot-NBP1-94076-img0008.jpg "Western Blot: RAI14 Antibody [NBP1-94076] - Analysis using Anti-RAI14 antibody NBP1-94076 (A) shows similar pattern to independent antibody NBP1-94075 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KAAMTDAMVPRSSYEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQEVNELLQKFQQAQEELAEMKRYAE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAI14 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Western_Blot_5882.jpg)
![Immunohistochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Immunohistochemistry_19616.jpg)
![Immunocytochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Oxidase_1_AF5928_Immunocytochemistry__Immunofluorescence_19724.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAI14 |
![Immunocytochemistry/Immunofluorescence: RAI14 Antibody [NBP1-94076] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RAI14-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-94076-img0006.jpg "Immunocytochemistry/Immunofluorescence: RAI14 Antibody [NBP1-94076] - Staining of human cell line A-431 shows localization to nucleus & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RAI14 Antibody [NBP1-94076] - Staining of human placenta shows strong membrane and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/RAI14-Antibody-Immunohistochemistry-Paraffin-NBP1-94076-img0002.jpg "Immunohistochemistry-Paraffin: RAI14 Antibody [NBP1-94076] - Staining of human placenta shows strong membrane and cytoplasmic positivity in trophoblastic cells.")
![Western Blot: RAI14 Antibody [NBP1-94076] - Western blot analysis in human cell lines U2OS and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/RAI14-Antibody-Western-Blot-NBP1-94076-img0007.jpg "Western Blot: RAI14 Antibody [NBP1-94076] - Western blot analysis in human cell lines U2OS and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Western Blot ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Western_Blot_5453.jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Immunocytochemistry_12849.jpg)
![Simple Western ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-simple-western-482021152036.jpg)
![Kallikrein 1 Antibody (323803) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Kallikrein 1 Antibody (323803) [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")