RAGEF2 Antibody - BSA Free

Western Blot: RAGEF2 Antibody [NBP3-35727] - Western blot analysis of various lysates using RAGEF2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAGEF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAGEF2 Antibody - BSA Free (NBP3-35727) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 145-240 of human RAGEF2 (NP_001157858).
  
  Sequence:
  INYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAPGEF6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 179 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for RAGEF2 Antibody - BSA Free

• DKFZp667N084
• DKFZp686I15116
• KIA001LB
• PDZ domain-containing guanine nucleotide exchange factor 2
• PDZ domain-containing guanine nucleotide exchange factor I
• PDZ-GEF2RA-GEF-2PDZGEF2PDZ domain containing guanine nucleotide exchange factor (GEF) 2
• RAGEF2
• Rap guanine nucleotide exchange factor (GEF) 6
• rap guanine nucleotide exchange factor 6

Background

Low similarity to human CAMP-GEFII; may be a membrane signalling protein; contains a PDZ, a cyclic nucleotide-binding, and a RasGEF domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAPGEF6