RAD54B Antibody

Images

 
Western Blot: RAD54B Antibody [NBP1-83416] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RAD54B Antibody [NBP1-83416] - Staining of human duodenum shows general cytoplasmic positivity with additional nuclear staining.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAD54B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SNISEPTKKVMEMIPQISSFCLVRDRNHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD54B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAD54B Protein (NBP1-83416PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAD54B Antibody

  • DNA repair and recombination protein RAD54B
  • EC 3.6.1
  • EC 3.6.4.-
  • fibrinogen silencer binding protein
  • FSBP
  • RAD54 homolog B (S. cerevisiae)
  • RAD54 homolog B
  • RDH54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-58116
Species: Hu
Applications: ICC/IF
NB110-13364
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IP, CyTOF-ready
NBP1-33387
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-181
Species: Hu, Mu
Applications: WB, IP
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-61070
Species: Hu
Applications: WB (-), IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-165
Species: Hu, Dr
Applications: ICC/IF (-), WB, IP
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP

Publications for RAD54B Antibody (NBP1-83416) (0)

There are no publications for RAD54B Antibody (NBP1-83416).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAD54B Antibody (NBP1-83416) (0)

There are no reviews for RAD54B Antibody (NBP1-83416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAD54B Antibody (NBP1-83416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAD54B Products

Bioinformatics Tool for RAD54B Antibody (NBP1-83416)

Discover related pathways, diseases and genes to RAD54B Antibody (NBP1-83416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAD54B Antibody (NBP1-83416)

Discover more about diseases related to RAD54B Antibody (NBP1-83416).
 

Pathways for RAD54B Antibody (NBP1-83416)

View related products by pathway.

PTMs for RAD54B Antibody (NBP1-83416)

Learn more about PTMs related to RAD54B Antibody (NBP1-83416).
 

Research Areas for RAD54B Antibody (NBP1-83416)

Find related products by research area.

Blogs on RAD54B

There are no specific blogs for RAD54B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAD54B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD54B