Recombinant Human Rad51C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Rad51C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-134 of Human RAD51C full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL

Protein/Peptide Type
Recombinant Protein
Gene
RAD51C

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Rad51C Protein

  • BROVCA3
  • DNA repair protein RAD51 homolog 3
  • FANCO
  • MGC104277
  • R51H3
  • RAD51 homolog C (S. cerevisiae)
  • RAD51 homolog C
  • RAD51L2RAD51 (S. cerevisiae) homolog C
  • RAD51-like protein 2
  • yeast RAD51 homolog 3

Background

RAD51C( AAH00667, 1 a.a. - 135 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-178
Species: Hu, Mu(-)
Applications: WB, ICC/IF
NB100-176
Species: Hu, Pm, Mu(-)
Applications: WB, ICC/IF
NB100-165
Species: Hu, Dr
Applications: ICC/IF (-), WB, IP
H00007516-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB2476
Species: Hu
Applications: WB, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-181
Species: Hu, Mu
Applications: WB, IP
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
21340002
Species: Hu
Applications: ELISA
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-92139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Rad51C Recombinant Protein (H00005889-P01) (0)

There are no publications for Rad51C Recombinant Protein (H00005889-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad51C Recombinant Protein (H00005889-P01) (0)

There are no reviews for Rad51C Recombinant Protein (H00005889-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rad51C Recombinant Protein (H00005889-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rad51C Products

Bioinformatics Tool for Rad51C Recombinant Protein (H00005889-P01)

Discover related pathways, diseases and genes to Rad51C Recombinant Protein (H00005889-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rad51C Recombinant Protein (H00005889-P01)

Discover more about diseases related to Rad51C Recombinant Protein (H00005889-P01).
 

Pathways for Rad51C Recombinant Protein (H00005889-P01)

View related products by pathway.

PTMs for Rad51C Recombinant Protein (H00005889-P01)

Learn more about PTMs related to Rad51C Recombinant Protein (H00005889-P01).
 

Research Areas for Rad51C Recombinant Protein (H00005889-P01)

Find related products by research area.

Blogs on Rad51C

There are no specific blogs for Rad51C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Mre11 Antibody
NB100-142
Rad50 Antibody (13B3)
NB100-147-0.1ml

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Rad51C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD51C