Rad51 Antibody

Images

 
Western Blot: Rad51 Antibody [NBP2-32622] - Analysis in human cell line MOLT-4.
Immunocytochemistry/ Immunofluorescence: Rad51 Antibody [NBP2-32622] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli.
Immunohistochemistry: Rad51 Antibody [NBP2-32622] - Staining of liver.
Immunohistochemistry: Rad51 Antibody [NBP2-32622] - Staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.
Immunohistochemistry: Rad51 Antibody [NBP2-32622] - Staining of liver cancer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rad51 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD51
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Rad51 Protein (NBP2-32622PEP)
Publications
Read Publications using
NBP2-32622 in the following applications:

  • WB
    3 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rad51 Antibody

  • BRCC5
  • HRAD51
  • HsRad51
  • HsT16930
  • RAD51 (S. cerevisiae) homolog (E coli RecA homolog)
  • RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae)
  • RAD51 homolog A
  • Rad51
  • RAD51ABRCA1/BRCA2-containing complex, subunit 5
  • RecA, E. coli, homolog of
  • RECADNA repair protein RAD51 homolog 1
  • RecA-like protein
  • recombination protein A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58116
Species: Hu
Applications: ICC/IF
MAB2476
Species: Hu
Applications: WB, IHC
NB100-181
Species: Hu, Mu
Applications: WB, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-165
Species: Hu, Dr
Applications: ICC/IF (-), WB, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47256
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00007516-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-32622
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Rad51 Antibody (NBP2-32622)(3)

Reviews for Rad51 Antibody (NBP2-32622) (0)

There are no reviews for Rad51 Antibody (NBP2-32622). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rad51 Antibody (NBP2-32622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rad51 Products

Bioinformatics Tool for Rad51 Antibody (NBP2-32622)

Discover related pathways, diseases and genes to Rad51 Antibody (NBP2-32622). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rad51 Antibody (NBP2-32622)

Discover more about diseases related to Rad51 Antibody (NBP2-32622).
 

Pathways for Rad51 Antibody (NBP2-32622)

View related products by pathway.

PTMs for Rad51 Antibody (NBP2-32622)

Learn more about PTMs related to Rad51 Antibody (NBP2-32622).
 

Research Areas for Rad51 Antibody (NBP2-32622)

Find related products by research area.

Blogs on Rad51.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

RAD51: The cell's 'Mr. Fix-it'
RAD51 is a recombinase protein encoded by RAD51 gene in humans. Human RAD51 family members are highly similar to bacterial RecA and yeast Rad51, both biochemically and structurally. It is a 339-amino acid protein that plays an important role in homolo...  Read full blog post.

NUP153 & 53BP1: A Novel DNA Repair Pathway
Mediating DNA damage is a crucial process, and one of the most important cellular guards against cancer. In response to DNA damage, sophisticated cellular machinery is recruited to repair the breaks, and if it fails, the cell is committed to death. De...  Read full blog post.

Determining DMC1's role in Homologus Recombination
The DMC1 gene encodes a 36.7 kDa nuclear protein involved in meiotic homologous recombination. This recombinase is functionally related to the yeast RAD51 and E. coli RecA genes. In contrast to RAD51, which functions in both mitotic and meiotic recomb...  Read full blog post.

Rad51 Antibody Reveals a Canine Model for Human Breast Cancer
Our antibody catalog includes an extensive range of Rad51 antibody reagents. Encoded by the RAD51 gene, the Rad51 protein plays a vital role in DNA repair, interacting with several other proteins, including BRCA1 and BRCA2, to effect homologous recomb...  Read full blog post.

Industrial Chemicals, Tumour Suppressor Genes and the Need for More Research
Human cancer research is the largest research area in our antibody database, with new oncogenes and cell lines being added all the time.Cancer triggers come from many sources, with a worrying amount of evidence to suggest that chemicals we’re in con...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rad51 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD51
Entrez