Rad51 Antibody

Western Blot: Rad51 Antibody [NBP2-32622] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Rad51 Antibody [NBP2-32622] - Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli.
Immunohistochemistry: Rad51 Antibody [NBP2-32622] - Liver
Immunohistochemistry: Rad51 Antibody [NBP2-32622] - Immunohistochemical staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.
Immunohistochemistry: Rad51 Antibody [NBP2-32622] - Liver cancer

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

Rad51 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKA
Predicted Species
Mouse (97%), Rat (99%)
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS and 40% glycerol (pH 7.2)
0.02% Sodium Azide
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified

Control Peptide
Rad51 Protein (NBP2-32622PEP)
Read Publication using
NBP2-32622 in the following applications:

  • WB
    1 publication

Alternate Names for Rad51 Antibody

  • BRCC5
  • HRAD51
  • HsRad51
  • HsT16930
  • RAD51 (S. cerevisiae) homolog (E coli RecA homolog)
  • RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae)
  • RAD51 homolog A
  • RAD51ABRCA1/BRCA2-containing complex, subunit 5
  • RecA, E. coli, homolog of
  • RECADNA repair protein RAD51 homolog 1
  • RecA-like protein
  • recombination protein A

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF (-), WB, IP
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt, Ca
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P

Publications for Rad51 Antibody (NBP2-32622)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Rad51 Antibody (NBP2-32622) (0)

There are no reviews for Rad51 Antibody (NBP2-32622). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rad51 Antibody (NBP2-32622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional Rad51 Antibody Products

Related Products by Gene

Bioinformatics Tool for Rad51 Antibody (NBP2-32622)

Discover related pathways, diseases and genes to Rad51 Antibody (NBP2-32622). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rad51 Antibody (NBP2-32622)

Discover more about diseases related to Rad51 Antibody (NBP2-32622).

Pathways for Rad51 Antibody (NBP2-32622)

View related products by pathway.

PTMs for Rad51 Antibody (NBP2-32622)

Learn more about PTMs related to Rad51 Antibody (NBP2-32622).

Research Areas for Rad51 Antibody (NBP2-32622)

Find related products by research area.

Blogs on Rad51.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

RAD51: The cell's 'Mr. Fix-it'
RAD51 is a recombinase protein encoded by RAD51 gene in humans. Human RAD51 family members are highly similar to bacterial RecA and yeast Rad51, both biochemically and structurally. It is a 339-amino acid protein that plays an important role in homolo...  Read full blog post.

NUP153 & 53BP1: A Novel DNA Repair Pathway
Mediating DNA damage is a crucial process, and one of the most important cellular guards against cancer. In response to DNA damage, sophisticated cellular machinery is recruited to repair the breaks, and if it fails, the cell is committed to death. De...  Read full blog post.

Determining DMC1's role in Homologus Recombination
The DMC1 gene encodes a 36.7 kDa nuclear protein involved in meiotic homologous recombination. This recombinase is functionally related to the yeast RAD51 and E. coli RecA genes. In contrast to RAD51, which functions in both mitotic and meiotic recomb...  Read full blog post.

Rad51 Antibody Reveals a Canine Model for Human Breast Cancer
Our antibody catalog includes an extensive range of Rad51 antibody reagents. Encoded by the RAD51 gene, the Rad51 protein plays a vital role in DNA repair, interacting with several other proteins, including BRCA1 and BRCA2, to effect homologous recomb...  Read full blog post.

Industrial Chemicals, Tumour Suppressor Genes and the Need for More Research
Human cancer research is the largest research area in our antibody database, with new oncogenes and cell lines being added all the time.Cancer triggers come from many sources, with a worrying amount of evidence to suggest that chemicals we’re in con...  Read full blog post.

Contact Information

Product PDFs

Gene Symbol RAD51

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-32622 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought