Rad50 Recombinant Protein Antigen

Images

 
There are currently no images for Rad50 Protein (NBP2-47316PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rad50 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD50.

Source: E. coli

Amino Acid Sequence: ELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKMEEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAD50
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47316.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rad50 Recombinant Protein Antigen

  • DNA repair protein RAD50
  • EC 3.6
  • EC 3.6.1.15
  • EC 3.6.3
  • EC 3.6.3.27
  • hRad50
  • NBSLD
  • RAD50 (S. cerevisiae) homolog
  • RAD50 homolog (S. cerevisiae)
  • Rad50
  • RAD502
  • RAD50-2

Background

Rad50 is a 153kDa protein that associates with Mre11 and p95 (Nibrin) to form a multiprotein complex involved in the double strand break repair process. Upon DNA damage, the complex translocates to the nucleus of damaged cells, binds DNA, and displays numerous enzymatic activities that are required for nonhomologous joining of DNA ends. Overall, Rad50 is important for DNA double-strand break repair, cell cycle checkpoint activation, telomere maintenance, and meiotic recombination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
NB100-56155
Species: Hu
Applications: IHC,  IHC-P, IP, WB
AF1085
Species: Mu
Applications: IHC, Neut, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-22128
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00007520-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, QFN, S-ELISA, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, WB

Publications for Rad50 Protein (NBP2-47316PEP) (0)

There are no publications for Rad50 Protein (NBP2-47316PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad50 Protein (NBP2-47316PEP) (0)

There are no reviews for Rad50 Protein (NBP2-47316PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rad50 Protein (NBP2-47316PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rad50 Products

Research Areas for Rad50 Protein (NBP2-47316PEP)

Find related products by research area.

Blogs on Rad50.

RAD50 and DNA Damage Response
DNA repair protein RAD50 is a component of the MRN complex (Mre11-RAD50-Nbs1) responsible for DNA double strand break (DSB) repair. DSBs are caused by ionizing radiation, certain chemotherapy drugs, metabolic reactive oxygen species (ROS), replication...  Read full blog post.

The MRE11 Complex and DNA Damage Response
The maintenance of genome stability depends on the DNA damage response (DDR) which is a complex signaling network including cell cycle checkpoints, DNA repair and damage tolerance pathways. The DDR complex has the ability to sense DNA damage and tra...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rad50 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD50