Rad23 Antibody

Immunohistochemistry: Rad23 Antibody [NBP2-38072] - Staining of human salivary gland shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Rad23 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ
• Predicted Species: Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAD23A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Rad23 Recombinant Protein Antigen (NBP2-38072PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Rad23 Antibody

• hHR23
• hHR23A
• HR23A
• Rad23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAD23A
• Uniprot:
  • P54725()