Rad21 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Rad21 Antibody [NBP1-83260] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Rad21 Antibody [NBP1-83260] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rad21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKAGQIDPEPVMPPQQVEQMEIPPVEL
Localization
Nucleus
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Rad21 Protein (NBP1-83260PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rad21 Antibody

  • double-strand-break repair protein rad21 homolog
  • hHR21FLJ25655
  • HR21
  • KIAA0078RAD21 (S. pombe) homolog
  • MCD1
  • Nuclear matrix protein 1
  • NXP-1
  • NXP1HRAD21
  • protein involved in DNA double-strand break repair
  • RAD21 homolog (S. pombe)
  • SCC1 homolog
  • SCC1FLJ40596

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-207
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-204
Species: Hu, Mu, Xp
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
29470002
Species: Ce
Applications: ELISA, ICC/IF, IHC
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-300
Species: Hu, Xp
Applications: WB, ICC/IF
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-85110
Species: Hu
Applications: ICC/IF, IHC, IF
NBP1-87957
Species: Hu
Applications: IHC, IHC-P
AF6820
Species: Mu, Rt
Applications: WB, IHC
NBP1-76645
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-298
Species: Hu, Xp
Applications: WB, ICC/IF, PLA
NBP1-84379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87904
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-83260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Rad21 Antibody (NBP1-83260) (0)

There are no publications for Rad21 Antibody (NBP1-83260).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad21 Antibody (NBP1-83260) (0)

There are no reviews for Rad21 Antibody (NBP1-83260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Rad21 Antibody (NBP1-83260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rad21 Products

Bioinformatics Tool for Rad21 Antibody (NBP1-83260)

Discover related pathways, diseases and genes to Rad21 Antibody (NBP1-83260). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rad21 Antibody (NBP1-83260)

Discover more about diseases related to Rad21 Antibody (NBP1-83260).
 

Pathways for Rad21 Antibody (NBP1-83260)

View related products by pathway.

PTMs for Rad21 Antibody (NBP1-83260)

Learn more about PTMs related to Rad21 Antibody (NBP1-83260).

Blogs on Rad21

There are no specific blogs for Rad21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rad21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD21
Entrez
Uniprot