Rac1 Antibody - Azide and BSA Free

Western Blot: Rac1 Antibody [NBP2-94917] - Western blot analysis of extracts of various cell lines, using Rac1 antibody (NBP2-94917) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NBP2-94917] - Immunofluorescence analysis of NIH-3T3 cells using Rac1 Rabbit pAb (NBP2-94917) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Rac1 Antibody [NBP2-94917] - Paraffin-embedded human gastric using Rac1 .

Western Blot: Rac1 Antibody [NBP2-94917] - Western blot analysis of extracts of A-431 cells, using Rac1 antibody (NBP2-94917) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NBP2-94917] - Immunofluorescence analysis of C6 cells using Rac1 Rabbit pAb (NBP2-94917) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Rac1 Antibody - Azide and BSA Free [Rac1] - Immunofluorescence analysis of C6 cells using Rac1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Rac1 Antibody - Azide and BSA Free [Rac1] - Immunofluorescence analysis of NIH/3T3 cells using Rac1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Rac1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Rac1 Antibody - Azide and BSA Free (NBP2-94917) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human Rac1/2/3 (NP_008839.2). MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Rac1 Antibody - Azide and BSA Free

• Cell migration-inducing gene 5 protein
• MGC111543
• p21-Rac1
• p21-Rac1migration-inducing gene 5
• Rac1
• Ras-like protein TC25
• ras-related C3 botulinum toxin substrate 1 (rho family, small GTP bindingprotein Rac1)
• ras-related C3 botulinum toxin substrate 1
• rho family, small GTP binding protein Rac1
• TC25
• TC-25

Background

Plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization and growth-factor induced formation of membrane ruffles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: RAC1