RABGAP1L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RABGAP1L Antibody [NBP2-31582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & cytosol.
Immunohistochemistry: RABGAP1L Antibody [NBP2-31582] - Staining of human kidney shows weak cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RABGAP1L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RABGAP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RABGAP1L Protein (NBP2-31582PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RABGAP1L Antibody

  • DKFZp686E1450
  • FLJ58037
  • FLJ79118
  • heart, liver (HLL)
  • HHLFLJ79254
  • RAB GTPase activating protein 1-like
  • rab GTPase-activating protein 1-like
  • TBC1 domain family, member 18
  • TBC1D18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57016
Species: Hu
Applications: WB
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP1-70510
Species: Hu
Applications: WB
H00022800-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-31582
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RABGAP1L Antibody (NBP2-31582) (0)

There are no publications for RABGAP1L Antibody (NBP2-31582).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RABGAP1L Antibody (NBP2-31582) (0)

There are no reviews for RABGAP1L Antibody (NBP2-31582). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RABGAP1L Antibody (NBP2-31582) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RABGAP1L Products

Bioinformatics Tool for RABGAP1L Antibody (NBP2-31582)

Discover related pathways, diseases and genes to RABGAP1L Antibody (NBP2-31582). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RABGAP1L Antibody (NBP2-31582)

Discover more about diseases related to RABGAP1L Antibody (NBP2-31582).
 

Pathways for RABGAP1L Antibody (NBP2-31582)

View related products by pathway.

PTMs for RABGAP1L Antibody (NBP2-31582)

Learn more about PTMs related to RABGAP1L Antibody (NBP2-31582).

Blogs on RABGAP1L

There are no specific blogs for RABGAP1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RABGAP1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RABGAP1L
Uniprot