RAB5C Antibody


Western Blot: RAB5C Antibody [NBP1-74182] - Mouse Pancreas lysate, concentration 1 ug/ml.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

RAB5C Antibody Summary

Synthetic peptides corresponding to the C terminal of Rab5c. Immunizing peptide sequence FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL.
Early Endosome Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Rab5c and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB5C Antibody

  • L1880
  • MGC117217
  • RAB5C, member of RAS oncogene family
  • RAB5C, member RAS oncogene family
  • RAB5CL
  • RAB5L
  • RABLMGC138857
  • ras-related protein Rab-5C


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Ma
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB

Publications for RAB5C Antibody (NBP1-74182) (0)

There are no publications for RAB5C Antibody (NBP1-74182).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB5C Antibody (NBP1-74182) (0)

There are no reviews for RAB5C Antibody (NBP1-74182). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB5C Antibody (NBP1-74182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RAB5C Products

Bioinformatics Tool for RAB5C Antibody (NBP1-74182)

Discover related pathways, diseases and genes to RAB5C Antibody (NBP1-74182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB5C Antibody (NBP1-74182)

Discover more about diseases related to RAB5C Antibody (NBP1-74182).

Pathways for RAB5C Antibody (NBP1-74182)

View related products by pathway.

PTMs for RAB5C Antibody (NBP1-74182)

Learn more about PTMs related to RAB5C Antibody (NBP1-74182).

Blogs on RAB5C

There are no specific blogs for RAB5C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAB5C Antibody and receive a gift card or discount.


Gene Symbol RAB5C