RAB5C Antibody

Images

 
Western Blot: RAB5C Antibody [NBP1-74182] - Mouse Pancreas lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB5C Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Rab5c. Immunizing peptide sequence FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL.
Marker
Early Endosome Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB5C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Rab5c and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAB5C Antibody

  • L1880
  • MGC117217
  • RAB5C, member of RAS oncogene family
  • RAB5C, member RAS oncogene family
  • RAB5CL
  • RAB5L
  • RABLMGC138857
  • ras-related protein Rab-5C

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-58938
Species: Hu, Ma
Applications: WB, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07079
Species: Hu
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74182
Species: Mu
Applications: WB

Publications for RAB5C Antibody (NBP1-74182) (0)

There are no publications for RAB5C Antibody (NBP1-74182).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB5C Antibody (NBP1-74182) (0)

There are no reviews for RAB5C Antibody (NBP1-74182). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB5C Antibody (NBP1-74182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB5C Products

Bioinformatics Tool for RAB5C Antibody (NBP1-74182)

Discover related pathways, diseases and genes to RAB5C Antibody (NBP1-74182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB5C Antibody (NBP1-74182)

Discover more about diseases related to RAB5C Antibody (NBP1-74182).
 

Pathways for RAB5C Antibody (NBP1-74182)

View related products by pathway.

PTMs for RAB5C Antibody (NBP1-74182)

Learn more about PTMs related to RAB5C Antibody (NBP1-74182).

Blogs on RAB5C

There are no specific blogs for RAB5C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB5C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB5C
Uniprot