Recombinant Human RAB43 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RAB43 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 212 of Human RAB43 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC

Protein/Peptide Type
Recombinant Protein
Gene
RAB43

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Hepes, 100 mM NaCl, pH 7.5, 5 mM DTT, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAB43 Protein

  • MGC90481
  • RAB11B
  • RAB41ISY1
  • RAB43, member RAS oncogene family
  • Ras-related protein Rab-41
  • ras-related protein Rab-43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83061
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-81855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-82949
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07079
Species: Hu
H00081876-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
H00339122-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RAB43 Recombinant Protein (H00339122-P01) (0)

There are no publications for RAB43 Recombinant Protein (H00339122-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB43 Recombinant Protein (H00339122-P01) (0)

There are no reviews for RAB43 Recombinant Protein (H00339122-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB43 Recombinant Protein (H00339122-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB43 Products

Bioinformatics Tool for RAB43 Recombinant Protein (H00339122-P01)

Discover related pathways, diseases and genes to RAB43 Recombinant Protein (H00339122-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB43 Recombinant Protein (H00339122-P01)

Discover more about diseases related to RAB43 Recombinant Protein (H00339122-P01).
 

Pathways for RAB43 Recombinant Protein (H00339122-P01)

View related products by pathway.

Research Areas for RAB43 Recombinant Protein (H00339122-P01)

Find related products by research area.

Blogs on RAB43

There are no specific blogs for RAB43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RAB43 Antibody (5G4)
H00339122-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAB43 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB43