RAB39 Antibody - Azide and BSA Free

Western Blot: RAB39 Antibody [H00054734-B01P] - Analysis of RAB39 expression in transfected 293T cell line by RAB39 polyclonal antibody. Lane 1: RAB39 transfected lysate(23.98 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAB39 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse RAB39 Antibody - Azide and BSA Free (H00054734-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RAB39 (AAH28064, 1 a.a. - 217 a.a.) full-length human protein. METIWIYQFRLIVIGDSTVGKSCLLRRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNAVHSSEEAVKPRKECFC
• Specificity: RAB39 - RAB39, member RAS oncogene family,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RAB39A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB39 Antibody - Azide and BSA Free

• rab-39
• RAB39, member RAS oncogene family
• RAB39A
• rab-related GTP-binding protein
• ras-related protein Rab-39A

Background

Belonging to the small GTPase superfamily/ Rab family, RAB39 plays an important role in cell formation and vesicular trafficking. More specifically, RAB39 proteins are involved in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. It also plays a role in the fusion of phagosomes with lysosomes. Additionally, the main molecular functions include GTP and nucleotide binding. RAB39 interacts with ATG5, CLN3, GABARAPL1, SH3GLB2 and STK11 and diseases include ataxia telangiectasia and malaria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB39A
• Entrez:
  • 54734(Human)
• Uniprot:
  • AAH28064(Human)