RAB26 Antibody - BSA Free

Western Blot: RAB26 Antibody [NBP3-35676] - Western blot analysis of various lysates using RAB26 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAB26 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAB26 Antibody - BSA Free (NBP3-35676) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human RAB26 (NP_055168.2).
  
  Sequence:
  MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB26
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for RAB26 Antibody - BSA Free

• RAB26, member RAS oncogene family
• Ras-related oncogene protein
• ras-related protein Rab-26
• V46133

Background

RAB26 belongs to the RAB family of proteins which are involved regulation of vesicular trafficking. RAB26 is involved in several biological processes including exocrine system development, protein transport, regulation of exocytosis and transport. RAB26 is known to have interactions with GCH1, RPH3AL, RIMS1, RPH3A and PCSK6. Studies of RAB26 have been conducted in relation to carcinoma, neuronitis and transitional cell carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB26