RAB21 Antibody (1G4)

Images

 
Western Blot: RAB21 Antibody (1G4) [H00023011-M03] - Detection against Immunogen (37.84 KDa)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB21 Antibody (1G4) Summary

Immunogen
RAB21 (NP_055814, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
Specificity
RAB21 - RAB21, member RAS oncogene family (1G4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB21
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00023011-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB21 Antibody (1G4)

  • KIAA0118ras-related protein Rab-21
  • RAB21, member RAS oncogene family

Background

RAB21 belongs to the RAB family of small GTP-binding proteins that regulate intracellular vesicle targeting (Opdam et al., 2000 [PubMed 10887961]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-87002
Species: Hu
Applications: WB
MAB6117
Species: Hu
Applications: IHC, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-56889
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
H00023682-M02
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-85968
Species: Hu
Applications: IHC, IHC-P, WB
H00338382-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37485
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
H00023011-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RAB21 Antibody (H00023011-M03)(1)

Reviews for RAB21 Antibody (H00023011-M03) (0)

There are no reviews for RAB21 Antibody (H00023011-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RAB21 Antibody (H00023011-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB21 Products

Bioinformatics Tool for RAB21 Antibody (H00023011-M03)

Discover related pathways, diseases and genes to RAB21 Antibody (H00023011-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB21 Antibody (H00023011-M03)

Discover more about diseases related to RAB21 Antibody (H00023011-M03).
 

Pathways for RAB21 Antibody (H00023011-M03)

View related products by pathway.

PTMs for RAB21 Antibody (H00023011-M03)

Learn more about PTMs related to RAB21 Antibody (H00023011-M03).
 

Research Areas for RAB21 Antibody (H00023011-M03)

Find related products by research area.

Blogs on RAB21

There are no specific blogs for RAB21, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB21 Antibody (1G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB21
Entrez
Uniprot