We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Rab20 Recombinant Protein Antigen

Images

 
There are currently no images for Rab20 Protein (NBP2-39096PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rab20 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAB20.

Source: E. coli

Amino Acid Sequence: KTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAB20
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39096.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rab20 Recombinant Protein Antigen

  • FLJ20429
  • RAB20, member RAS oncogene family
  • ras-related protein Rab-20

Background

RAB20, also known as Ras-related protein Rab-20, is a 234 amino acid protein that is 26 kDa, belongs to the small GTPase superfamily, expressed in 15 of 18 exocrine pancreatic adenocarcinomas, plays a role in apical endocytosis/recycling, maturation and acidification of phagosomes that engulf pathogens such as S.aureus and M.tuberculosis, and in the fusion of phagosomes with lysosomes. This protein is currently being studied for its involvement in hemophagocytic lymphohistiocytosis, pancreatic carcinoma, pancreatitis, adenocarcinoma, and carcinoma. RAB20 protein has interactions with SMURF1, SMAD4 and TGFBR1 in Epithelial Tight Junctions pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00338382-M01
Species: Hu
Applications: ELISA, IP, WB
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
NBP1-85966
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-86366
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00005873-M02
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, S-ELISA, WB
NBP1-84764
Species: Hu
Applications: IHC,  IHC-P
NBP3-41302
Species: Hu, Mu, Po, Rt
Applications: IHC, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00010981-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-38234
Species: Hu
Applications: IHC,  IHC-P
NBP2-02599
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-51599
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, KD, WB
H00004218-M02
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
NBP2-23392
Species: Hu
Applications: PAGE, WB
NBP3-46828
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
H00009367-M01
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-39096PEP
Species: Hu
Applications: AC

Publications for Rab20 Protein (NBP2-39096PEP) (0)

There are no publications for Rab20 Protein (NBP2-39096PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab20 Protein (NBP2-39096PEP) (0)

There are no reviews for Rab20 Protein (NBP2-39096PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rab20 Protein (NBP2-39096PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rab20 Products

Research Areas for Rab20 Protein (NBP2-39096PEP)

Find related products by research area.

Blogs on Rab20

There are no specific blogs for Rab20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rab20 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB20