RAB19B Antibody - BSA Free

Western Blot: RAB19B Antibody [NBP2-85573] - Host: Rabbit. Target Name: RAB19. Sample Type: RPMI-8226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RAB19B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAB19B Antibody - BSA Free (NBP2-85573) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAB19B. Peptide sequence: GVYTETQQNTIGVDFTVRSLDIDGKKVKMQVWDTAGQERFRTITQSYYRS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RAB19B Antibody - BSA Free

• RAB19, member RAS oncogene family
• RAB19BGTP-binding protein RAB19B
• ras-related protein Rab-19

Background

RAB19B, also known as Ras-related protein Rab-19, is a 24 kDa 217 amino acid protein with a longer 30kDa 264 isoform. RAB19B belongs to the Rab family and can be found in the cell membrane. Current research on RAB19B is being conducted in relation to the diseases pilocytic astrocytoma and astrocytoma. RAB19B is linked to the transport pathway where it interacts with RANBP1, RANBP2, RANGAP1, ARHGDIA and KPNB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB19