RAB12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RAB12 Antibody [NBP1-90976] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: RAB12 Antibody [NBP1-90976] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RAB12 Protein (NBP1-90976PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB12 Antibody

  • FLJ45927
  • MGC104724
  • putative Ras-related protein Rab-12
  • RAB12, member RAS oncogene family
  • ras-related protein Rab-12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85799
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6380
Species: Mu
Applications: WB
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-60771
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB
NBP2-56973
Species: Hu
Applications: WB, ICC/IF
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6544
Species: Hu
Applications: IHC
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-92308
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBL1-13921
Species: Hu
NBP2-56548
Species: Hu
Applications: ICC/IF

Publications for RAB12 Antibody (NBP1-90976) (0)

There are no publications for RAB12 Antibody (NBP1-90976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB12 Antibody (NBP1-90976) (0)

There are no reviews for RAB12 Antibody (NBP1-90976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RAB12 Antibody (NBP1-90976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB12 Products

Bioinformatics Tool for RAB12 Antibody (NBP1-90976)

Discover related pathways, diseases and genes to RAB12 Antibody (NBP1-90976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB12 Antibody (NBP1-90976)

Discover more about diseases related to RAB12 Antibody (NBP1-90976).
 

Pathways for RAB12 Antibody (NBP1-90976)

View related products by pathway.

Blogs on RAB12

There are no specific blogs for RAB12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB12