Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen

Images

 
There are currently no images for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen (NBP1-87309PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDP1.

Source: E. coli

Amino Acid Sequence: YLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87309.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen

  • [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
  • EC 3.1.3
  • EC 3.1.3.43
  • MGC119646
  • PDH
  • PDP 1
  • PDP1
  • PDPC 1
  • PDPC
  • PDPFLJ32517
  • PPM2C
  • PPM2CFLJ56179
  • Protein phosphatase 2C
  • protein phosphatase 2C, magnesium-dependent, catalytic subunit
  • pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase
  • Pyruvate dehydrogenase phosphatase catalytic subunit 1
  • Pyruvate Dehydrogenase Phosphatase
  • pyruvate dehyrogenase phosphatase catalytic subunit 1

Background

Pyruvate dehydrogenase (E1) is one of the three components (E1, E2, and E3) of the large pyruvate dehydrogenase complex. Pyruvate dehydrogenase kinases catalyze phosphorylation of serine residues of E1 to inactivate the E1 component and inhibit the complex. Pyruvate dehydrogenase phosphatases catalyze the dephosphorylation and activation of the E1 component to reverse the effects of pyruvate dehydrogenase kinases. Pyruvate dehydrogenase phosphatase is a heterodimer consisting of catalytic and regulatory subunits. Two catalytic subunits have been reported; one is predominantly expressed in skeletal muscle and another one is is much more abundant in the liver. The catalytic subunit, encoded by this gene, is the former, and belongs to the protein phosphatase 2C (PP2C) superfamily. Along with the pyruvate dehydrogenase complex and pyruvate dehydrogenase kinases, this enzyme is located in the mitochondrial matrix. Mutation in this gene causes pyruvate dehydrogenase phosphatase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NBP1-49536
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-94660
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-07047
Species: Hu, Mu
Applications: WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
H00005164-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NB110-93479
Species: Hu, Mu, Rt
Applications: Flow, IB, ICC/IF, IP, KO, Simple Western, WB
NBP2-34065
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82912
Species: Hu
Applications: IHC,  IHC-P
NBP1-87309PEP
Species: Hu
Applications: AC

Publications for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen (NBP1-87309PEP) (0)

There are no publications for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen (NBP1-87309PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen (NBP1-87309PEP) (0)

There are no reviews for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen (NBP1-87309PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen (NBP1-87309PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Products

Blogs on Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C

There are no specific blogs for Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDP1