PYGL Antibody [Allophycocyanin]

Product Discontinued

PYGL Antibody [Allophycocyanin] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 690-847 of human PYGL (NP_002854.3).
  
  Sequence:
  IGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PYGL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for PYGL Antibody [Allophycocyanin]

• EC 2.4.1.1
• glycogen phosphorylase, liver form
• GSD6
• phosphorylase, glycogen, liver
• phosphorylase, glycogen; liver
• PYGL

Background

Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. Activity of phosphorylase is controlled both by allosteric means (through the noncovalent binding of metabolites) and by covalent modification. Thus AMP allosterically activates, whereas ATP, ADP, and glucose 6 phosphate allosterically inhibit, phosphorylase B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PYGL