PX19 Antibody

Images

 
Western Blot: PX19 Antibody [NBP1-88093] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: PX19 Antibody [NBP1-88093] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: PX19 Antibody [NBP1-88093] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PX19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRELID1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PX19 Protein (NBP1-88093PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PX19 Antibody

  • 25 kDa protein of relevant evolutionary and lymphoid interest
  • CGI-106
  • MGC87972
  • PRELI domain containing 1
  • PRELImitochondrial
  • protein of relevant evolutionary and lymphoid interest

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2758
Species: Hu
Applications: WB, IHC
NB100-1116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
H00005013-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-39100
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-45925
Species: Hu, Mu, Ca
Applications: WB, IF
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for PX19 Antibody (NBP1-88093) (0)

There are no publications for PX19 Antibody (NBP1-88093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PX19 Antibody (NBP1-88093) (0)

There are no reviews for PX19 Antibody (NBP1-88093). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PX19 Antibody (NBP1-88093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PX19 Products

Bioinformatics Tool for PX19 Antibody (NBP1-88093)

Discover related pathways, diseases and genes to PX19 Antibody (NBP1-88093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PX19 Antibody (NBP1-88093)

Discover more about diseases related to PX19 Antibody (NBP1-88093).
 

Pathways for PX19 Antibody (NBP1-88093)

View related products by pathway.

PTMs for PX19 Antibody (NBP1-88093)

Learn more about PTMs related to PX19 Antibody (NBP1-88093).

Blogs on PX19

There are no specific blogs for PX19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PX19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRELID1