PUS10 Antibody

Western Blot: PUS10 Antibody [NBP1-56369] - HCT15 cell lysate, concentration 0.2-1 ug/ml.

Product Discontinued

PUS10 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PUS10 (pseudouridylate synthase 10) The peptide sequence was selected from the middle region of PUS10. Peptide sequence AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PUS10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PUS10 Antibody

• CCDC139
• coiled-coil domain containing 139
• Coiled-coil domain-containing protein 139
• DOBIMGC126729
• EC 5.4.99
• EC 5.4.99.-
• FLJ32312
• MGC126755
• pseudouridine synthase 10
• pseudouridylate synthase 10
• Psi55 synthase
• PUS1
• putative tRNA pseudouridine synthase Pus10
• tRNA pseudouridine 55 synthase
• tRNA pseudouridylate synthase
• tRNA-uridine isomerase

Background

Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotide modification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylate synthases, such as PUS10, catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. These enzymes also act as RNA chaperones, facilitating the correct folding and assembly of tRNAs (McCleverty et al., 2007 [PubMed 17900615]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PUS10
• Uniprot:
  • Q3MIT2(Human)