Recombinant Human PUF60 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PUF60 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 114-223 of Human PUF60

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PUF60
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PUF60 GST (N-Term) Protein

  • FBP interacting repressor
  • FBP-interacting repressor
  • FIRpoly-U binding splicing factor PUF60
  • FLJ31379
  • FUSE-binding protein-interacting repressor
  • poly(U)-binding-splicing factor PUF60
  • poly-U binding splicing factor 60KDa
  • Ro ribonucleoprotein binding protein 1
  • Ro ribonucleoprotein-binding protein 1
  • Ro-binding protein 1
  • roBP1
  • RoBPI
  • siah binding protein 1,60 kDa poly(U)-binding-splicing factor
  • Siah-binding protein 1
  • siah-BP1
  • SIAHBP1pyrimidine tract binding splicing factor

Background

The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-61060
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
NBP2-16542
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBL1-11392
Species: Hu
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP3-03903
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP3-04662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, KO, ELISA(Sta)
NBP2-45693
Species: Hu
Applications: WB, IHC
NBP1-76959
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC
NBP2-85297
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-93726
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-84680
Species: Hu
Applications: WB, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PUF60 Partial Recombinant Protein (H00022827-Q01) (0)

There are no publications for PUF60 Partial Recombinant Protein (H00022827-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUF60 Partial Recombinant Protein (H00022827-Q01) (0)

There are no reviews for PUF60 Partial Recombinant Protein (H00022827-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PUF60 Partial Recombinant Protein (H00022827-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PUF60 Products

Bioinformatics Tool for PUF60 Partial Recombinant Protein (H00022827-Q01)

Discover related pathways, diseases and genes to PUF60 Partial Recombinant Protein (H00022827-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PUF60 Partial Recombinant Protein (H00022827-Q01)

Discover more about diseases related to PUF60 Partial Recombinant Protein (H00022827-Q01).
 

Pathways for PUF60 Partial Recombinant Protein (H00022827-Q01)

View related products by pathway.

Blogs on PUF60

There are no specific blogs for PUF60, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PUF60 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PUF60