PTTG1IP Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PTTG1IP Antibody - BSA Free (NBP2-57370) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA |
| Predicted Species |
Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PTTG1IP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PTTG1IP Antibody - BSA Free
Background
PTTG1IP, also known as Pituitary tumor-transforming gene 1 protein-interacting protein, is a 180 amino-acid protein that is 20 kDa, and may facilitate PTTG1 nuclear translocation and potentiates the transcriptional activation of basic fibroblast growth factor by PTTG1. Disease research is currently being performed with relation to this protein and pituitary tumor intrahepatic cholangiocarcinoma, pituitary adenoma, cholangiocarcinoma, adenoma astrocytoma, breast cancer, and thyroiditis. PTTG1IP protein involvement has been observed with relation to PTTG1, UBC and RAB4A in protein import into nucleus pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Rt
Applications: ICC/IF
Publications for PTTG1IP Antibody (NBP2-57370) (0)
There are no publications for PTTG1IP Antibody (NBP2-57370).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PTTG1IP Antibody (NBP2-57370) (0)
There are no reviews for PTTG1IP Antibody (NBP2-57370).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PTTG1IP Antibody (NBP2-57370) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PTTG1IP Products
Blogs on PTTG1IP