PTTG1IP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PTTG1IP Antibody [NBP2-57370] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTTG1IP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEA
Specificity
Specificity of human PTTG1IP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTTG1IP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PTTG1IP Antibody

  • C21orf1putative surface glycoprotein C21orf1 precursor10C21orf3pituitary tumor-transforming gene 1 protein-interacting protein
  • PBFPTTG-binding factor
  • pituitary tumor-transforming 1 interacting protein
  • Pituitary tumor-transforming gene protein-binding factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75659
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89196
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP, In vitro, Flow-IC
NBP2-61712
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-57370
Species: Hu, Rt
Applications: ICC/IF

Publications for PTTG1IP Antibody (NBP2-57370) (0)

There are no publications for PTTG1IP Antibody (NBP2-57370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTTG1IP Antibody (NBP2-57370) (0)

There are no reviews for PTTG1IP Antibody (NBP2-57370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PTTG1IP Antibody (NBP2-57370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PTTG1IP Products

Bioinformatics Tool for PTTG1IP Antibody (NBP2-57370)

Discover related pathways, diseases and genes to PTTG1IP Antibody (NBP2-57370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTTG1IP Antibody (NBP2-57370)

Discover more about diseases related to PTTG1IP Antibody (NBP2-57370).
 

Pathways for PTTG1IP Antibody (NBP2-57370)

View related products by pathway.

PTMs for PTTG1IP Antibody (NBP2-57370)

Learn more about PTMs related to PTTG1IP Antibody (NBP2-57370).

Blogs on PTTG1IP

There are no specific blogs for PTTG1IP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTTG1IP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTTG1IP