Recombinant Human PTRH1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PTRH1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 214 of Human PTRH1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLILDHIRERSQGPSLGP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
PTRH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
49.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PTRH1 GST (N-Term) Protein

  • C9orf115
  • chromosome 9 open reading frame 115
  • EC 3.1.1.29
  • MGC51999
  • peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae)
  • probable peptidyl-tRNA hydrolase
  • PTH
  • PTH1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59322
Species: Hu
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
2629-FG
Species: Mu
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP1-40067
Species: Hu, Mu, Po, Bv, Ca, Eq, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
H00138428-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PTRH1 Recombinant Protein (H00138428-P01) (0)

There are no publications for PTRH1 Recombinant Protein (H00138428-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTRH1 Recombinant Protein (H00138428-P01) (0)

There are no reviews for PTRH1 Recombinant Protein (H00138428-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTRH1 Recombinant Protein (H00138428-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PTRH1 Products

Bioinformatics Tool for PTRH1 Recombinant Protein (H00138428-P01)

Discover related pathways, diseases and genes to PTRH1 Recombinant Protein (H00138428-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PTRH1

There are no specific blogs for PTRH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PTRH1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTRH1