PTRF Antibody (1F7) - Azide and BSA Free

Immunohistochemistry-Paraffin: PTRF Antibody (1F7) [H00284119-M02] - Analysis of monoclonal antibody to PTRF on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.

• Reactivity: Hu
• Applications: ELISA, ICC/IF, IHC
• Clone: 1F7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PTRF Antibody (1F7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PTRF Antibody (1F7) - Azide and BSA Free (H00284119-M02) is a monoclonal antibody validated for use in IHC, ELISA and ICC/IF. Anti-PTRF Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PTRF (NP_036364, 233 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPF
• Specificity: PTRF - polymerase I and transcript release factor
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CAVIN1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
• Application Notes: Antibody reactive against recombinant protein on ELISA. It has also been used for immunohistochemistry on paraffin sections.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTRF Antibody (1F7) - Azide and BSA Free

• CAVIN
• cavin-1
• CGL4
• FLJ90031
• polymerase I and transcript release factor
• RNA polymerase I and transcript release factor
• TTF-I interacting peptide 12

Background

PTRF (polymerase I and transcript release factor) was first identified as a TTF-I and RNA polymerase I (RNA Pol I) interacting protein that functions in the termination of RNA polymerase I transcription. PTRF has also been described as a protein that localizes to the plasma membrane and caveolae of adipocytes and whose localization is under the control of insulin. In this context, PTRF has been observed to associate with a lipase and have an extranuclear role in the regulation of lipolysis. PTRF is also known as FKSG13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTRF Antibody (H00284119-M02)(1)

Publication using H00284119-M02

• Hansen CG, Bright NA, Howard G, Nichols BJ. SDPR induces membrane curvature and functions in the formation of caveolae. Nat Cell Biol. 2009-06-14 [PMID: 19525939]

Bioinformatics

• Gene Symbol: CAVIN1
• Entrez:
  • 284119(Human)
• OMIM:
  • 603198(Human)
• Uniprot:
  • NP_036364(Human)