PTPRB Antibody

Immunocytochemistry/Immunofluorescence: PTPRB Antibody [NBP2-56421] - Staining of human cell line A-431 shows localization to plasma membrane & vesicles. Antibody staining is shown in green.

Product Discontinued

PTPRB Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSD
• Predicted Species: Mouse (95%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPRB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PTPRB Antibody

• DKFZp686E2262
• DKFZp686H15164
• EC 3.1.3.48
• FLJ44133
• HPTPB
• HPTP-BETA
• MGC142023
• MGC59935
• protein tyrosine phosphatase, receptor type, B
• protein tyrosine phosphatase, receptor type, beta polypeptide
• Protein-tyrosine phosphatase beta
• PTPB
• receptor-type tyrosine-protein phosphatase beta
• R-PTP-BETA
• Vascular endothelial protein tyrosine phosphatase
• VEPTP
• VE-PTP

Background

PTPRB is a member of the protein tyrosine phosphatase (PTP) family. The family comprises at least 37 proteins, characterized by a catalytic phosphatase domain of approximately 240 amino acids, and includes both transmembrane and cytosolic enzymes. PTP1B is a transmembrane PTP. The PTPs have high substrate specificity for phosphotyrosyl proteins, at the primary sequence level sharing little similarity with the protein serine phosphatases, protein threonine phosphatases, or the acid and alkaline phosphatases. PTP beta interacts with and regulates the tyrosine phosphorylation level of catenins, which are critical in physiological and pathological events such as cell migration, adhesion and transformation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPRB