PTP pi/PTPRU Recombinant Protein Antigen

Images

 
There are currently no images for PTP pi/PTPRU Protein (NBP1-81873PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PTP pi/PTPRU Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTPRU.

Source: E. coli

Amino Acid Sequence: TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTPRU
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81873.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTP pi/PTPRU Recombinant Protein Antigen

  • FMI
  • hPTP-J
  • pancreatic carcinoma phosphatase 2
  • PCP2
  • PCP-2
  • pi R-PTP-Psi
  • protein tyrosine phosphatase J
  • protein tyrosine phosphatase, receptor type, U
  • protein-tyrosine phosphatase J
  • protein-tyrosine phosphatase pi
  • PTP pi
  • PTP
  • PTP-J
  • PTP-PI
  • PTPPSI
  • PTP-RO
  • Receptor protein tyrosine phosphatase hPTP-J
  • R-PTP-PSI

Background

The protein encoded by the PTPRU gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracellular catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP (MAM) domain, Ig-like and fibronectin type III-like repeats. This PTP was thought to play roles in cell-cell recognition and adhesion. Studies of the similar gene in mice suggested the role of this PTP in early neural development. The expression of this gene was reported to be regulated by phorbol myristate acetate (PMA) or calcium ionophore in Jurkat T lymphoma cells. Three alternatively spliced transcript variants, which encode distinct proteins, have been reported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3954
Species: Mu, Rt
Applications: Simple Western, WB
NBP1-83276
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91228
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP2-42172
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
NBP2-12793
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NB100-60666
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
MAB1934
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr,  IHC-P, WB
NBP1-81873PEP
Species: Hu
Applications: AC

Publications for PTP pi/PTPRU Protein (NBP1-81873PEP) (0)

There are no publications for PTP pi/PTPRU Protein (NBP1-81873PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTP pi/PTPRU Protein (NBP1-81873PEP) (0)

There are no reviews for PTP pi/PTPRU Protein (NBP1-81873PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTP pi/PTPRU Protein (NBP1-81873PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTP pi/PTPRU Products

Research Areas for PTP pi/PTPRU Protein (NBP1-81873PEP)

Find related products by research area.

Blogs on PTP pi/PTPRU

There are no specific blogs for PTP pi/PTPRU, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTP pi/PTPRU Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRU