We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PTP gamma/PTPRG Recombinant Protein Antigen

Images

 
There are currently no images for PTP gamma/PTPRG Recombinant Protein Antigen (NBP2-57477PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PTP gamma/PTPRG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTP gamma/PTPRG.

Source: E. coli

Amino Acid Sequence: ALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTPRG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57477.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTP gamma/PTPRG Recombinant Protein Antigen

  • EC 3.1.3.48
  • H_RG317H01.1
  • HPTPG
  • protein tyrosine phosphatase, receptor type, G
  • protein tyrosine phosphatase, receptor type, gamma polypeptide
  • Protein-tyrosine phosphatase gamma
  • PTP gamma
  • PTPG
  • PTPGprotein tyrosine phosphatase gamma
  • PTPRG
  • receptor type protein tyrosine phosphatase gamma
  • receptor tyrosine phosphatase gamma
  • receptor-type protein phosphatase gamma
  • receptor-type tyrosine-protein phosphatase gamma
  • RPTPG
  • R-PTP-GAMMA

Background

PTPRG is encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region of this PTP contains a carbonic anhydrase-like (CAH) domain, which is also found in the extracellular region of PTPRBETA/ZETA. This gene is located in a chromosomal region that is frequently deleted in renal cell carcinoma and lung carcinoma, thus is thought to be a candidate tumor suppressor gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7475
Species: Hu, Rt
Applications: WB
NBP2-82145
Species: Hu
Applications: ELISA
H00005250-B02P
Species: Hu
Applications: ICC/IF, WB
AF3697
Species: Hu
Applications: WB
MAB2688
Species: Hu
Applications: WB
NBP1-89062
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-94767
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP3-14454
Species: Hu
Applications: IHC,  IHC-P
NBP2-42172
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-57477PEP
Species: Hu
Applications: AC

Publications for PTP gamma/PTPRG Recombinant Protein Antigen (NBP2-57477PEP) (0)

There are no publications for PTP gamma/PTPRG Recombinant Protein Antigen (NBP2-57477PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTP gamma/PTPRG Recombinant Protein Antigen (NBP2-57477PEP) (0)

There are no reviews for PTP gamma/PTPRG Recombinant Protein Antigen (NBP2-57477PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTP gamma/PTPRG Recombinant Protein Antigen (NBP2-57477PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTP gamma/PTPRG Products

Research Areas for PTP gamma/PTPRG Recombinant Protein Antigen (NBP2-57477PEP)

Find related products by research area.

Blogs on PTP gamma/PTPRG

There are no specific blogs for PTP gamma/PTPRG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTP gamma/PTPRG Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRG