PTP alpha/PTPRA Antibody


Immunocytochemistry/ Immunofluorescence: PTP alpha/PTPRA Antibody [NBP2-57255] - Staining of human cell line HaCaT shows localization to nucleus & vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

PTP alpha/PTPRA Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPP
Specificity of human PTP alpha/PTPRA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTP alpha/PTPRA Recombinant Protein Antigen (NBP2-57255PEP)

Reactivity Notes

Mouse 80%, Rat 80%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PTP alpha/PTPRA Antibody

  • EC
  • HLPR
  • LRP
  • LRPHPTPalpha
  • protein tyrosine phosphatase, receptor type, A
  • Protein-tyrosine phosphatase alpha
  • PTP alpha
  • PTPAreceptor type, alpha polypeptide
  • PTPase-alpha
  • PTPLCA-related phosphatase
  • PTPRL2
  • receptor-type tyrosine-protein phosphatase alpha
  • R-PTP-alpha
  • tyrosine phosphatase alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC

Publications for PTP alpha/PTPRA Antibody (NBP2-57255) (0)

There are no publications for PTP alpha/PTPRA Antibody (NBP2-57255).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTP alpha/PTPRA Antibody (NBP2-57255) (0)

There are no reviews for PTP alpha/PTPRA Antibody (NBP2-57255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PTP alpha/PTPRA Antibody (NBP2-57255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PTP alpha/PTPRA Antibody (NBP2-57255)

Discover related pathways, diseases and genes to PTP alpha/PTPRA Antibody (NBP2-57255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTP alpha/PTPRA Antibody (NBP2-57255)

Discover more about diseases related to PTP alpha/PTPRA Antibody (NBP2-57255).

Pathways for PTP alpha/PTPRA Antibody (NBP2-57255)

View related products by pathway.

PTMs for PTP alpha/PTPRA Antibody (NBP2-57255)

Learn more about PTMs related to PTP alpha/PTPRA Antibody (NBP2-57255).

Research Areas for PTP alpha/PTPRA Antibody (NBP2-57255)

Find related products by research area.

Blogs on PTP alpha/PTPRA

There are no specific blogs for PTP alpha/PTPRA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PTP alpha/PTPRA Antibody and receive a gift card or discount.


Gene Symbol PTPRA