PTP alpha/PTPRA Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PTP alpha/PTPRA Antibody [NBP2-57255] - Staining of human cell line HaCaT shows localization to nucleus & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PTP alpha/PTPRA Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPRA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PTP alpha/PTPRA Recombinant Protein Antigen (NBP2-57255PEP)

Reactivity Notes

Mouse 80%, Rat 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PTP alpha/PTPRA Antibody - BSA Free

• EC 3.1.3.48
• HEPTP
• HLPR
• LRP
• LRPHPTPalpha
• protein tyrosine phosphatase, receptor type, A
• Protein-tyrosine phosphatase alpha
• PTP alpha
• PTPAreceptor type, alpha polypeptide
• PTPase-alpha
• PTPLCA-related phosphatase
• PTPRA
• PTPRL2
• receptor-type tyrosine-protein phosphatase alpha
• RPTPA
• R-PTP-alpha
• tyrosine phosphatase alpha

Background

PTP alpha is encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. This PTP has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation. Three alternatively spliced variants of this gene, which encode two distinct isoforms, have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPRA