PTHLH/PTHrP Antibody

Images

 
Western Blot: PTHLH Antibody [NBP1-74098] - Mouse Brain Lysate 1ug/ml Gel Concentration 10-20%
Immunohistochemistry-Paraffin: PTHLH Antibody [NBP1-74098] - Human Lung tissue, 5ug/ml.

Product Details

Summary
Product Discontinued
View other related PTHLH/PTHrP Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74098
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PTHLH/PTHrP Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Pthlh. Immunizing peptide sequence EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK.
Clonality
Polyclonal
Host
Rabbit
Gene
PTHLH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against Pthlh and was validated on Western blot.
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTHLH/PTHrP Antibody

  • BDE2
  • HHM
  • MGC14611
  • Osteostatin
  • parathyroid hormone-like hormone
  • Parathyroid hormone-like protein
  • parathyroid hormone-related protein
  • PLPosteostatin
  • PTHLH
  • PTHR
  • PTH-related protein
  • PTHRP
  • PTH-rP
  • PTHRPparathyroid hormone-like related protein

Background

Pthlh is a neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. It regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is required for skeletal homeostasis. It promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. It upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-22568
Species: Hu
Applications: IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
1705-HH/CF
Species: Hu, Mu
NBP1-40067
Species: Hu, Mu, Po, Bv, Ca, Eq, Mk, Pm
Applications: WB, ICC/IF, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-74098
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for PTHLH/PTHrP Antibody (NBP1-74098) (0)

There are no publications for PTHLH/PTHrP Antibody (NBP1-74098).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTHLH/PTHrP Antibody (NBP1-74098) (0)

There are no reviews for PTHLH/PTHrP Antibody (NBP1-74098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTHLH/PTHrP Antibody (NBP1-74098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTHLH/PTHrP Products

Bioinformatics Tool for PTHLH/PTHrP Antibody (NBP1-74098)

Discover related pathways, diseases and genes to PTHLH/PTHrP Antibody (NBP1-74098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTHLH/PTHrP Antibody (NBP1-74098)

Discover more about diseases related to PTHLH/PTHrP Antibody (NBP1-74098).
 

Pathways for PTHLH/PTHrP Antibody (NBP1-74098)

View related products by pathway.

PTMs for PTHLH/PTHrP Antibody (NBP1-74098)

Learn more about PTMs related to PTHLH/PTHrP Antibody (NBP1-74098).

Blogs on PTHLH/PTHrP

There are no specific blogs for PTHLH/PTHrP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTHLH/PTHrP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTHLH
Entrez
Uniprot