PTH Recombinant Protein Antigen

Images

 
There are currently no images for PTH Recombinant Protein Antigen (NBP2-55612PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PTH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTH.

Source: E. coli

Amino Acid Sequence: KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55612.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PTH Recombinant Protein Antigen

  • Parathormone
  • Parathyrin
  • parathyroid hormone 1
  • parathyroid hormone
  • PTH
  • PTH1

Background

Parathyroid hormone (PTH), which is also designated parathyrin, is an 84 amino acid single chain peptide that functions to regulate calcium metabolism by raising blood levels of calcium through various mechanisms. PTH stimulates bone formation to increase bone mass and strength in rats and humans. Within the PTH molecule, the essential activity is associated with the first 34 amino acids at the amino-terminus of the molecule. The gene encoding PTH maps to human chromosome 11p15.3-p15.1. Parathyroid hormone-related protein (PTH-rP) is an autocrine factor that is structurally related to PTH yet, unlike PTH, which is synthesized only by the parathyroid cells, PTH-rP is synthesized by several cell types. PTH-rP regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Isolated from the culture medium of a human lung cancer cell line, PTH-rP produces PTH-like effects that are characterized as humoral hypercalcemia of malignancy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB6734
Species: Hu
Applications: IHC
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
NBP1-89953
Species: Hu, Mu
Applications: IHC,  IHC-P
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
291-G1
Species: Hu
Applications: BA
MAB26291
Species: Mu
Applications: IHC
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DY805
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP1-40067
Species: Bv, Ca, Eq, Hu, Pm, Mu, Po, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
NBP2-55612PEP
Species: Hu
Applications: AC

Publications for PTH Recombinant Protein Antigen (NBP2-55612PEP) (0)

There are no publications for PTH Recombinant Protein Antigen (NBP2-55612PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTH Recombinant Protein Antigen (NBP2-55612PEP) (0)

There are no reviews for PTH Recombinant Protein Antigen (NBP2-55612PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PTH Recombinant Protein Antigen (NBP2-55612PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTH Products

Research Areas for PTH Recombinant Protein Antigen (NBP2-55612PEP)

Find related products by research area.

Blogs on PTH

There are no specific blogs for PTH, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PTH Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTH