PTCD3 Antibody

Images

 
Western Blot: PTCD3 Antibody [NBP1-84126] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PTCD3 Antibody [NBP1-84126] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: PTCD3 Antibody [NBP1-84126] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTCD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTAL
Specificity
Specificity of human PTCD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTCD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTCD3 Protein (NBP1-84126PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTCD3 Antibody

  • DKFZp666K071
  • FLJ20758
  • Pentatricopeptide repeat domain 3
  • pentatricopeptide repeat-containing protein 3, mitochondrial
  • Transformation-related gene 15 protein
  • TRG-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82109
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19436
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26603
Species: Hu
Applications: WB, IP
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
H00054606-M05
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-26176
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP2-37393
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2682
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready, IF
NBP2-45938
Species: Hu
Applications: WB, Flow, IHC, IF
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NB100-1032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-46034
Species: Hu, Ca, Mk
Applications: WB, IHC
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85286
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-84126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTCD3 Antibody (NBP1-84126) (0)

There are no publications for PTCD3 Antibody (NBP1-84126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTCD3 Antibody (NBP1-84126) (0)

There are no reviews for PTCD3 Antibody (NBP1-84126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTCD3 Antibody (NBP1-84126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PTCD3 Antibody (NBP1-84126)

Discover related pathways, diseases and genes to PTCD3 Antibody (NBP1-84126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTCD3 Antibody (NBP1-84126)

Discover more about diseases related to PTCD3 Antibody (NBP1-84126).
 

Pathways for PTCD3 Antibody (NBP1-84126)

View related products by pathway.

Research Areas for PTCD3 Antibody (NBP1-84126)

Find related products by research area.

Blogs on PTCD3

There are no specific blogs for PTCD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTCD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTCD3