PSMD14 Antibody (5V0H3)

Western Blot: PSMD14 Antibody (5V0H3) [NBP3-16837] - Western blot analysis of various lysates using PSMD14 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: PSMD14 Antibody (5V0H3) [NBP3-16837] - Confocal imaging of U-2OS cells using PSMD14 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 40x.

Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: PSMD14 Antibody (5V0H3) [NBP3-16837] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PSMD14 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 5V0H3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PSMD14 Antibody (5V0H3) Summary

• Description: Novus Biologicals Rabbit PSMD14 Antibody (5V0H3) (NBP3-16837) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 112-210 of human PSMD14 (O00487). YHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PSMD14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PSMD14 Antibody (5V0H3)

• EC 3.1.2.15
• EC 3.4.19.-
• PAD1
• POH126S proteasome non-ATPase regulatory subunit 14,26S proteasome regulatory subunit RPN11
• proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
• Rpn11
• RPN11,26S proteasome-associated PAD1 homolog 1

Background

PSMD14 is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMD14