PSG1 Antibody - BSA Free

Western Blot: PSG1 Antibody [NBP2-82316] - Host: Rabbit. Target Name: PSG1. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PSG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PSG1 Antibody - BSA Free (NBP2-82316) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSG1. Peptide sequence: FTYYRSGEVLYLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PSG1 Antibody - BSA Free

• B1G1
• B1G1CD66 antigen-like family member F
• CD66f antigen
• CD66f
• DHFRP2
• Fetal liver non-specific cross-reactive antigen 1/2
• FLJ90598
• FLJ90654
• FL-NCA-1/2
• PBG1
• pregnancy specific beta-1-glycoprotein 1
• pregnancy-specific B-1 glycoprotein
• Pregnancy-specific beta-1 glycoprotein C/D
• pregnancy-specific beta-1-glycoprotein 1
• Pregnancy-specific glycoprotein 1
• PS-beta-C/D
• PS-beta-G-1
• PSbG1
• PSBG-1
• PSBG1SP1
• PSG1
• PSG-1
• PSG95
• PSGGA
• PSGGAPSG95
• PSGIIA

Background

PSG1, also known as Pregnancy-specific beta-1-glycoprotein 1, is a 106 amino acid protein that is 12 kDa, secreteded in high quantity during pregnancy, member of the immunoglobulin (Ig) superfamily. Current research is being performed on several diseases and disorders including factor vii deficiency, gestational trophoblastic neoplasm, trophoblastic neoplasm, pre-eclampsia, spontaneous abortion, transitional cell carcinoma, germinoma, down syndrome, basal cell carcinoma, eclampsia, choriocarcinoma, lung carcinoma, carcinoma, esophageal carcinoma, esophagitis, infertility, lung cancer, and alcoholism. This protein has shown an interaction with UTP14A in pregnancy processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSG1