PSAT1 Antibody

Western Blot: PSAT1 Antibody [H00029968-A01] - Representative immunoblots for PSAT in HL-60 leukemia cells incubated for 48 hours in medium containing the indicated decreasing concentrations of Gln. Image collected and cropped by CiteAb from the following publication (oncotarget.com/article/6426/text/), licensed under a CC-BY license.

Western Blot: PSAT1 Antibody [H00029968-A01] - Analysis of PSAT1 expression in MES-SA/Dx5.

Western Blot: PSAT1 Antibody [H00029968-A01] - Analysis of PSAT1 expression in IMR-32 (Cat # L008V1).

Gln deprivation promotes the serine pathway. Representative immunoblots for (C) PHGDH and (D) PSAT in HL-60 leukemia cells incubated for 48 hours in medium containing the indicated decreasing concentrations of Gln. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26625201), licensed under a CC-BY licence.

Product Discontinued

PSAT1 Antibody Summary

• Immunogen: PSAT1 (NP_478059, 262 a.a. - 370 a.a.) partial recombinant protein with GST tag. GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL
• Specificity: PSAT1 - phosphoserine aminotransferase 1
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PSAT1
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50% Glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSAT1 Antibody

• EC 2.6.1.52
• EPIP
• Phosphohydroxythreonine aminotransferase
• phosphoserine aminotransferase 1
• phosphoserine aminotransferase
• PSAMGC1460
• PSAT
• PSAT1
• PSATD
• PSATendometrial progesterone-induced protein

Background

The protein encoded by this gene is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PSAT1 Antibody (H00029968-A01)(14)

Publications using H00029968-A01

• Rossi M, Altea-Manzano P, Demicco M et al. PHGDH heterogeneity potentiates cancer cell dissemination and metastasis Nature 2022-05-01 [PMID: 35585241] (Western Blot, Human)
• Rinaldi G, Pranzini E, Van Elsen J et al. In�Vivo Evidence for Serine Biosynthesis-Defined Sensitivity of Lung Metastasis, but Not of Primary Breast Tumors, to mTORC1 Inhibition Molecular Cell 2021-01-01 [PMID: 33340488] (Western Blot, Human)
• Robert B, Douglas B, Keisuke Y et al. Neurons Release Serine to Support mRNA Translation in Pancreatic Cancer. Cell. 2020-11-02 [PMID: 33142117]
• Bodinier R, Leiba J, Sabra A et al. LrrkA, a kinase with leucine-rich repeats, links folate sensing with Kil2 activity and intracellular killing. Cell Microbiol. 2019-11-07 [PMID: 31652367]
• Diehl F, Lewis C, Fiske B et al. Cellular redox state constrains serine synthesis and nucleotide production to impact cell proliferation. Nat Metab. 2019-09-16 [PMID: 31598584]
• Wang LW, Shen H, Nobre L et al. Epstein-Barr-Virus-Induced One-Carbon Metabolism Drives B Cell Transformation Cell Metab. 2019-06-25 [PMID: 31257153]
• Yang CS, Stampouloglou E, Kingston NM et al. Glutamine-utilizing transaminases are a metabolic vulnerability of TAZ/YAP-activated cancer cells. EMBO Rep 2018-04-16 [PMID: 29661856]
• Krall AS, Xu S, Graeber TG et al. Asparagine promotes cancer cell proliferation through use as an amino acid exchange factor. Nat Commun 2016-04-29 [PMID: 27126896] (WB)
• Polet F, Corbet C, Pinto A et al. Reducing the serine availability complements the inhibition of the glutamine metabolism to block leukemia cell growth. Oncotarget 2016-01-12 [PMID: 26625201] (WB)
• Ma L, Tao Y, Duran A et al. Control of Nutrient Stress-Induced Metabolic Reprogramming by PKCzeta in Tumorigenesis. Cell 2013-01-31 [PMID: 23374352] (WB, Human)
• Possemato R, Marks KM, Shaul YD et al. Functional genomics reveal that the serine synthesis pathway is essential in breast cancer. Nature 2011-08-01 [PMID: 21760589] (WB, Human)
• Wang LW Metabolic Remodeling of Human B-Cells During Latent Epstein-Barr Virus (EBV) Infection Thesis 2019-01-01 (WB, Human)
• Krall AS, Mullen PJ, Surjono F et al. Asparagine couples mitochondrial respiration to ATF4 activity and tumor growth Cell metabolism 2021-02-17 [PMID: 33609439]
• Locasale JW, Grassian AR, Melman T et al. Phosphoglycerate dehydrogenase diverts glycolytic flux and contributes to oncogenesis. Nat Genet;43(9):869-874. 2011-01-01 [PMID: 21804546]

Bioinformatics

• Gene Symbol: PSAT1
• Entrez:
  • 29968(Human)
• Uniprot:
  • NP_478059(Human)