PSAT1 Antibody

Images

 
Western Blot: PSAT1 Antibody [H00029968-A01] - Representative immunoblots for PSAT in HL-60 leukemia cells incubated for 48 hours in medium containing the indicated decreasing concentrations of Gln. Image collected and ...read more
Western Blot: PSAT1 Antibody [H00029968-A01] - Analysis of PSAT1 expression in MES-SA/Dx5.
Western Blot: PSAT1 Antibody [H00029968-A01] - Analysis of PSAT1 expression in IMR-32 (Cat # L008V1).

Product Details

Summary
Reactivity Hu, BaSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PSAT1 Antibody Summary

Immunogen
PSAT1 (NP_478059, 262 a.a. - 370 a.a.) partial recombinant protein with GST tag. GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL
Specificity
PSAT1 - phosphoserine aminotransferase 1
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PSAT1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publications using
H00029968-A01 in the following applications:

  • WB
    5 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSAT1 Antibody

  • EC 2.6.1.52
  • EPIP
  • Phosphohydroxythreonine aminotransferase
  • phosphoserine aminotransferase 1
  • phosphoserine aminotransferase
  • PSAMGC1460
  • PSAT
  • PSAT1
  • PSATD
  • PSATendometrial progesterone-induced protein

Background

The protein encoded by this gene is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY262
Species: Hu
Applications: ELISA
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-06046
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-15184
Species: Hu, Rt
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, Simple Western
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00029968-A01
Species: Hu, Ba
Applications: WB, ELISA

Publications for PSAT1 Antibody (H00029968-A01)(9)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(5)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00029968-A01 Applications Species
Wang LW, Shen H, Nobre L et al. Epstein-Barr-Virus-Induced One-Carbon Metabolism Drives B Cell Transformation Cell Metab. Jun 25 2019 [PMID: 31257153]
Yang CS, Stampouloglou E, Kingston NM et al. Glutamine-utilizing transaminases are a metabolic vulnerability of TAZ/YAP-activated cancer cells. EMBO Rep Apr 16 2018 [PMID: 29661856]
Krall AS, Xu S, Graeber TG et al. Asparagine promotes cancer cell proliferation through use as an amino acid exchange factor. Nat Commun 2016 Apr 29 [PMID: 27126896] (WB) WB
Polet F, Corbet C, Pinto A et al. Reducing the serine availability complements the inhibition of the glutamine metabolism to block leukemia cell growth. Oncotarget 2016 Jan 12 [PMID: 26625201] (WB) WB
Ma L, Tao Y, Duran A et al. Control of Nutrient Stress-Induced Metabolic Reprogramming by PKCzeta in Tumorigenesis. Cell 2013 Jan 31 [PMID: 23374352] (WB, Human) WB Human
Possemato R, Marks KM, Shaul YD e al. Functional genomics reveal that the serine synthesis pathway is essential in breast cancer Nature 2011 Aug 18 [PMID: 21760589] (WB, Human) WB Human
Wang LW Metabolic Remodeling of Human B-Cells During Latent Epstein-Barr Virus (EBV) Infection Thesis Jan 1 2019 (WB, Human) WB Human
Krall AS, Mullen PJ, Surjono F et al. Asparagine couples mitochondrial respiration to ATF4 activity and tumor growth Cell metabolism Feb 17 2021 [PMID: 33609439]
Locasale JW, Grassian AR, Melman T et al. Phosphoglycerate dehydrogenase diverts glycolytic flux and contributes to oncogenesis. Nat Genet;43(9):869-874. 2011 [PMID: 21804546]

Reviews for PSAT1 Antibody (H00029968-A01) (0)

There are no reviews for PSAT1 Antibody (H00029968-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSAT1 Antibody (H00029968-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSAT1 Products

Bioinformatics Tool for PSAT1 Antibody (H00029968-A01)

Discover related pathways, diseases and genes to PSAT1 Antibody (H00029968-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSAT1 Antibody (H00029968-A01)

Discover more about diseases related to PSAT1 Antibody (H00029968-A01).
 

Pathways for PSAT1 Antibody (H00029968-A01)

View related products by pathway.

PTMs for PSAT1 Antibody (H00029968-A01)

Learn more about PTMs related to PSAT1 Antibody (H00029968-A01).

Blogs on PSAT1

There are no specific blogs for PSAT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSAT1
Entrez
Uniprot