PRSS16 Antibody

Images

 
Western Blot: PRSS16 Antibody [NBP1-91559] - Human 293T, Antibody Dilution: 1.0 ug/ml PRSS16 is supported by BioGPS gene expression data to be expressed in HEK293T.
Western Blot: PRSS16 Antibody [NBP1-91559] - Human kidney lysate, concentration 0.2-1 ug/ml.
Western Blot: PRSS16 Antibody [NBP1-91559] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRSS16 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human PRSS16. Peptide sequence SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRSS16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against PRSS16 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRSS16 Antibody

  • FLJ36271
  • FLJ44172
  • protease, serine, 16 (thymus)
  • thymus specific serine peptidase
  • thymus-specific serine protease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00000826-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2705
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-67333
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33380
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-86022
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-89689
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87850
Species: Hu
Applications: IHC, IHC-P
NBP1-91559
Species: Hu
Applications: WB

Publications for PRSS16 Antibody (NBP1-91559) (0)

There are no publications for PRSS16 Antibody (NBP1-91559).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRSS16 Antibody (NBP1-91559) (0)

There are no reviews for PRSS16 Antibody (NBP1-91559). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRSS16 Antibody (NBP1-91559) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PRSS16 Antibody (NBP1-91559)

Discover related pathways, diseases and genes to PRSS16 Antibody (NBP1-91559). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRSS16 Antibody (NBP1-91559)

Discover more about diseases related to PRSS16 Antibody (NBP1-91559).
 

Pathways for PRSS16 Antibody (NBP1-91559)

View related products by pathway.

Blogs on PRSS16

There are no specific blogs for PRSS16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRSS16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS16
Uniprot