PRSS16 Antibody

Images

 
Immunohistochemistry-Paraffin: PRSS16 Antibody [NBP1-90649] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PRSS16 Antibody [NBP1-90649] - Staining of human stomach shows moderate to strong cytoplasmic positivity in chief cells.
Immunohistochemistry-Paraffin: PRSS16 Antibody [NBP1-90649] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PRSS16 Antibody [NBP1-90649] - Staining of human skin shows weak to moderate granular cytoplasmic positivity in stratum basale.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRSS16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQAVAQTNSYYGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRSS16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRSS16 Protein (NBP1-90649PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRSS16 Antibody

  • FLJ36271
  • FLJ44172
  • protease, serine, 16 (thymus)
  • thymus specific serine peptidase
  • thymus-specific serine protease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000826-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF826
Species: Hu, Mu
Applications: WB
NBP2-33380
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-86022
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-16851
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PRSS16 Antibody (NBP1-90649) (0)

There are no publications for PRSS16 Antibody (NBP1-90649).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRSS16 Antibody (NBP1-90649) (0)

There are no reviews for PRSS16 Antibody (NBP1-90649). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRSS16 Antibody (NBP1-90649) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRSS16 Products

PRSS16 NBP1-90649

Bioinformatics Tool for PRSS16 Antibody (NBP1-90649)

Discover related pathways, diseases and genes to PRSS16 Antibody (NBP1-90649). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRSS16 Antibody (NBP1-90649)

Discover more about diseases related to PRSS16 Antibody (NBP1-90649).
 

Pathways for PRSS16 Antibody (NBP1-90649)

View related products by pathway.

Blogs on PRSS16

There are no specific blogs for PRSS16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRSS16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS16