PRRX2 Recombinant Protein Antigen

Images

 
There are currently no images for PRRX2 Recombinant Protein Antigen (NBP2-58891PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PRRX2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRRX2.

Source: E. coli

Amino Acid Sequence: RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRRX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58891.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRRX2 Recombinant Protein Antigen

  • paired related homeobox 2
  • paired-like homeodomain protein PRX2
  • Paired-related homeobox protein 2
  • PMX2paired mesoderm homeobox protein 2
  • PRX-2
  • PRX2MGC19843

Background

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06067
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
H00009588-M01
Species: Bv, Hu
Applications: DB, ELISA, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
NBP3-27806
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-19777
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP3-32740
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
H00005083-M03
Species: Hu, Rt
Applications: ELISA, KD, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB7547
Species: Hu
Applications: ICC, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-58891PEP
Species: Hu
Applications: AC

Publications for PRRX2 Recombinant Protein Antigen (NBP2-58891PEP) (0)

There are no publications for PRRX2 Recombinant Protein Antigen (NBP2-58891PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRX2 Recombinant Protein Antigen (NBP2-58891PEP) (0)

There are no reviews for PRRX2 Recombinant Protein Antigen (NBP2-58891PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRRX2 Recombinant Protein Antigen (NBP2-58891PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRRX2 Products

Array NBP2-58891PEP

Blogs on PRRX2

There are no specific blogs for PRRX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRRX2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRX2