Recombinant Human PRRX2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PRRX2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 151-253 of Human PRRX2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:WFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRRX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRRX2 Protein

  • paired related homeobox 2
  • paired-like homeodomain protein PRX2
  • Paired-related homeobox protein 2
  • PMX2paired mesoderm homeobox protein 2
  • PRX-2
  • PRX2MGC19843

Background

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13816
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89481
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7547
Species: Hu
Applications: WB, ICC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
H00051450-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for PRRX2 Partial Recombinant Protein (H00051450-Q02) (0)

There are no publications for PRRX2 Partial Recombinant Protein (H00051450-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRX2 Partial Recombinant Protein (H00051450-Q02) (0)

There are no reviews for PRRX2 Partial Recombinant Protein (H00051450-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRRX2 Partial Recombinant Protein (H00051450-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRRX2 Products

Bioinformatics Tool for PRRX2 Partial Recombinant Protein (H00051450-Q02)

Discover related pathways, diseases and genes to PRRX2 Partial Recombinant Protein (H00051450-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRRX2 Partial Recombinant Protein (H00051450-Q02)

Discover more about diseases related to PRRX2 Partial Recombinant Protein (H00051450-Q02).
 

Pathways for PRRX2 Partial Recombinant Protein (H00051450-Q02)

View related products by pathway.

PTMs for PRRX2 Partial Recombinant Protein (H00051450-Q02)

Learn more about PTMs related to PRRX2 Partial Recombinant Protein (H00051450-Q02).

Blogs on PRRX2

There are no specific blogs for PRRX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PRRX2 Antibody
H00051450-D01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRRX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRX2