PRRX1 Antibody

Images

 
Western Blot: PRRX1 Antibody [NBP2-13816] - Analysis in human cell line U-138 MG.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Immunohistochemical staining of human testis cancer (embryonal carcinoma) shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Image provided via verified customer review.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Immunohistochemical staining of human uterine cervix shows moderate nuclear positivity in basal cells of squamous epithelium.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Immunohistochemical staining of human malignant glioma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Immunohistochemical staining of human liver shows no nuclear positivity in hepatocytes, as expected.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts, as well as Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRRX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEK KKRKQRRNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRRX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRRX1 Protein (NBP2-13816PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-13816 in the following applications:

Publications
Read Publications using
NBP2-13816 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23355395)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRRX1 Antibody

  • Homeobox protein PHOX1
  • paired mesoderm homeo box 1
  • paired mesoderm homeobox 1 isoform pmx-1b
  • paired mesoderm homeobox protein 1
  • paired related homeobox 1
  • Paired-related homeobox protein 1
  • PHOX1PRX-1
  • PMX1PRX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051450-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-20228
Species: Hu, Ze
Applications: WB
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP2-19777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP2-13816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PRRX1 Antibody (NBP2-13816)(3)

Review for PRRX1 Antibody (NBP2-13816) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 application: IHC-P.

Reviews using NBP2-13816:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin PRRX1 NBP2-13816
Enlarge
reviewed by:
Anonymous
IHC-P 02/28/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRRX1 Antibody (NBP2-13816) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRRX1 Products

Bioinformatics Tool for PRRX1 Antibody (NBP2-13816)

Discover related pathways, diseases and genes to PRRX1 Antibody (NBP2-13816). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRRX1 Antibody (NBP2-13816)

Discover more about diseases related to PRRX1 Antibody (NBP2-13816).
 

Pathways for PRRX1 Antibody (NBP2-13816)

View related products by pathway.

PTMs for PRRX1 Antibody (NBP2-13816)

Learn more about PTMs related to PRRX1 Antibody (NBP2-13816).
 

Research Areas for PRRX1 Antibody (NBP2-13816)

Find related products by research area.

Blogs on PRRX1

There are no specific blogs for PRRX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
02/28/2014
Application: IHC-P
Species:

Bioinformatics

Gene Symbol PRRX1