PRRX1 Antibody


Genetic Strategies: Western Blot: PRRX1 Antibody [NBP2-13816] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1, using anti-PRRX1 antibody. Remaining relative intensity is more
Orthogonal Strategies: Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Staining in human testis and liver tissues. Corresponding PRRX1 RNA-seq data are presented for the same tissues.
Western Blot: PRRX1 Antibody [NBP2-13816] - Staining of human malignant glioma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Image provided via verified customer review.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Staining of human liver shows no nuclear positivity in hepatocytes, as expected.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts, as well as Leydig cells.
Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Staining of human uterine cervix shows moderate nuclear positivity in basal cells of squamous epithelium.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD

Order Details

PRRX1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEK KKRKQRRNR
Specificity of human PRRX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRRX1 Protein (NBP2-13816PEP)
Reviewed Applications
Read 1 Review rated 4
NBP2-13816 in the following applications:

Read Publications using
NBP2-13816 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23355395)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PRRX1 Antibody

  • Homeobox protein PHOX1
  • paired mesoderm homeo box 1
  • paired mesoderm homeobox 1 isoform pmx-1b
  • paired mesoderm homeobox protein 1
  • paired related homeobox 1
  • Paired-related homeobox protein 1
  • PHOX1PRX-1
  • PMX1PRX1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu
Species: Hu
Applications: WB, ChIP, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for PRRX1 Antibody (NBP2-13816)(3)

Review for PRRX1 Antibody (NBP2-13816) (1) 41

Average Rating: 4
(Based on 1 review)

Reviews using NBP2-13816:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin PRRX1 NBP2-13816
reviewed by:
IHC-P 02/28/2014



Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRRX1 Antibody (NBP2-13816) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PRRX1 Products

Bioinformatics Tool for PRRX1 Antibody (NBP2-13816)

Discover related pathways, diseases and genes to PRRX1 Antibody (NBP2-13816). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRRX1 Antibody (NBP2-13816)

Discover more about diseases related to PRRX1 Antibody (NBP2-13816).

Pathways for PRRX1 Antibody (NBP2-13816)

View related products by pathway.

PTMs for PRRX1 Antibody (NBP2-13816)

Learn more about PTMs related to PRRX1 Antibody (NBP2-13816).

Research Areas for PRRX1 Antibody (NBP2-13816)

Find related products by research area.

Blogs on PRRX1

There are no specific blogs for PRRX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IHC-P


Gene Symbol PRRX1