PRRX1 Antibody

Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Staining of human malignant glioma shows moderate to strong nuclear positivity in tumor cells.

Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Staining of human liver shows no nuclear positivity in hepatocytes, as expected.

Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts, as well as Leydig cells.

Immunohistochemistry-Paraffin: PRRX1 Antibody [NBP2-13816] - Staining of human uterine cervix shows moderate nuclear positivity in basal cells of squamous epithelium.

Product Discontinued

PRRX1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEK KKRKQRRNR
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRRX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. PRRX1 antibody validated for IHC-P from a verified customer review.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23355395)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PRRX1 Antibody

• Homeobox protein PHOX1
• paired mesoderm homeo box 1
• paired mesoderm homeobox 1 isoform pmx-1b
• paired mesoderm homeobox protein 1
• paired related homeobox 1
• Paired-related homeobox protein 1
• PHOX1PRX-1
• PMX1PRX1

Background

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PRRX1 Antibody (NBP2-13816)(7)

Publications using NBP2-13816

• Shintani A, Higuchi M Protocol for isolating adult pituitary stem/progenitor cells in mice STAR protocols 2022-06-17 [PMID: 35677611] (Mouse)
• Rodriguez-Tirado C, Kale N, Carlini MJ et al. NR2F1 is a barrier to dissemination of early stage breast cancer cells Cancer research [PMID: 35471456] (ICC/IF, Mouse)
• Joko R, Yamada D, Nakamura M et al. PRRX1 promotes malignant properties in human osteosarcoma Translational Oncology 2021-01-01 [PMID: 33395745]
• Song I, Kim K, Lim S et al. Expression and prognostic significance of epithelial-mesenchymal transition-related markers and phenotype in serous ovarian cancer. Pathology - Research and Practice 2018-07-01 [PMID: 30082157] (IF/IHC, Human)
• Yi K, Kim H, Chung Y et al. Clinicopathologic Correlations of E-cadherin and Prrx-1 Expression Loss in Hepatocellular Carcinoma. J Pathol Transl Med 2016-09-01 [PMID: 27580127] (IF/IHC)
• Hardin H, Guo Z, Shan W et al. The Roles of the Epithelial-Mesenchymal Transition Marker PRRX1 and MicroRNA 146b-5p in Papillary Thyroid Carcinoma Progression. Am. J. Pathol. 2014-06-17 [PMID: 24946010] (IHC-P, Human)
  
  Details:
  Used for IHC-P of PRRX1 on whole sections of FFPE lymph node tissues /seven Papillary Thyroid Carcinoma (PTCs) and one anaplastic thyroid carcinoma (ATC) TMAs with automated immunostaining procedure/ Lab Vision 360 LV-1 Autostainer system - 1:20 dilution, incubation 1 hr followed by biotinylated goat anti-rabbit IgG for 15 minutes, 4+ streptavidin–horseradish peroxidase treatment for 15 minutes followed by DAB and hematoxylin 1 minute each. PRRX1 staining evaluated based on the presence or absence of nuclear immunoreactivity in thyroid epithelial cells.
• Reichert M, Takano S, Burstin J et al. The Prrx1 Homeodomain Transcription Factor Plays a Central Role in Pancreatic Regeneration and Carcinogenesis Genes Dev. 2013-02-01 [PMID: 23355395]

Review for PRRX1 Antibody (NBP2-13816) (1)

Average Rating: 4

(Based on 1 review)

reviewed by: Verified Customer IHC-P 02/28/2014

Summary

• Application: Immunohistochemistry-Paraffin

Bioinformatics

• Gene Symbol: PRRX1