PRRG4 Antibody

Images

 
Western Blot: PRRG4 Antibody [NBP2-85541] - WB Suggested Anti-Prrg4 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Liver

Product Details

Summary
Reactivity Mu, Hu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRRG4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of PRRG4. Peptide sequence: CIRSLKDSEHAPEEVFASKEAANIFMHRRLLNNRFDLELFTPGDLERECY The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Rat (93%), Canine (93%), Equine (93%), Bovine (100%), Guinea Pig (100%), Rabbit (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
PRRG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRRG4 Antibody

  • proline rich Gla (G-carboxyglutamic acid) 4 (transmembrane)
  • Proline-rich Gla protein 4
  • TMG4PRGP4Proline-rich gamma-carboxyglutamic acid protein 4
  • transmembrane gamma-carboxyglutamic acid protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NB110-60011
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
7999-AH
Species: Hu
NBP1-90155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-20136
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, In vivo, ISH
MAB2104
Species: Hu, Mu
Applications: WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB2806
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89796
Species: Hu, Mu
Applications: IHC, IHC-P
MAB6918
Species: Hu
Applications: WB
NBP1-84110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59992
Species: Hu
Applications: WB
NBP1-87229
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19112
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-85541
Species: Mu, Hu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for PRRG4 Antibody (NBP2-85541) (0)

There are no publications for PRRG4 Antibody (NBP2-85541).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRG4 Antibody (NBP2-85541) (0)

There are no reviews for PRRG4 Antibody (NBP2-85541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRRG4 Antibody (NBP2-85541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PRRG4 Products

Bioinformatics Tool for PRRG4 Antibody (NBP2-85541)

Discover related pathways, diseases and genes to PRRG4 Antibody (NBP2-85541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRRG4 Antibody (NBP2-85541)

Discover more about diseases related to PRRG4 Antibody (NBP2-85541).
 

Pathways for PRRG4 Antibody (NBP2-85541)

View related products by pathway.

Blogs on PRRG4

There are no specific blogs for PRRG4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRRG4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRG4