PRRG3 Antibody

Images

 
Western Blot: PRRG3 Antibody [NBP1-59992] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PRRG3 Antibody [NBP1-59992] - Human 721_B, Antibody Dilution: 1.0 ug/ml PRRG3 is supported by BioGPS gene expression data to be expressed in 721_B.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRRG3 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRRG3(proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane)) The peptide sequence was selected from the N terminal of PRRG3. Peptide sequence EEICSYEEVKEVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMYVVVPLL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRRG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PRRG3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRRG3 Antibody

  • PRGP3MGC156177
  • proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane)
  • Proline-rich gamma-carboxyglutamic acid protein 3
  • Proline-rich Gla protein 3
  • TMG3MGC149510
  • transmembrane gamma-carboxyglutamic acid protein 3

Background

The exact function of PRRG3 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1129-ER
Species: Hu
Applications: BA
NBP1-89796
Species: Hu, Mu
Applications: IHC, IHC-P
AF2608
Species: Hu
Applications: WB
NBP1-71819
Species: Hu, Mu
Applications: ChIP, IP, WB
NBP1-80673
Species: Hu
Applications: IHC, IHC-P, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP1-77350
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF470
Species: Mu
Applications: IHC, Neut, WB
H00009248-B01P
Species: Hu, Mu, Rt
Applications: Flow, KO, WB
NBP1-87229
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-76924
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-93048
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-83213
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89329
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47863
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010214-P01
Species: Hu
Applications: ELISA, AP, IHC, IHC-P, PA, PAGE, WB
NBP1-25966
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-94071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00053405-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF2667
Species: Hu
Applications: IHC, WB

Publications for PRRG3 Antibody (NBP1-59992) (0)

There are no publications for PRRG3 Antibody (NBP1-59992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRG3 Antibody (NBP1-59992) (0)

There are no reviews for PRRG3 Antibody (NBP1-59992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRRG3 Antibody (NBP1-59992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRRG3 Products

Bioinformatics Tool for PRRG3 Antibody (NBP1-59992)

Discover related pathways, diseases and genes to PRRG3 Antibody (NBP1-59992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRRG3 Antibody (NBP1-59992)

Discover more about diseases related to PRRG3 Antibody (NBP1-59992).

Blogs on PRRG3

There are no specific blogs for PRRG3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRRG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRRG3
Uniprot