PRR7 Antibody - BSA Free

Western Blot: PRR7 Antibody [NBP2-85538] - WB Suggested Anti-PRR7 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Jurkat cell lysate

Immunohistochemistry: PRR7 Antibody [NBP2-85538] - Human Lung

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PRR7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRR7 Antibody - BSA Free (NBP2-85538) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRR7. Peptide sequence: AEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRR7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PRR7 Antibody - BSA Free

• MGC10772
• proline rich 7 (synaptic)
• proline-rich protein 7
• Synaptic proline-rich membrane protein

Background

PRR7/TRAP3 (proline-rich 7, transmembrane adaptor protein 3) is a 28 kDa transmembrane adaptor protein ubiquitously expressed at low level (most in brain). Its amino acid sequence is extremely conserved among mammalian and other species. PRR7/TRAP3 contains potential palmitoylation motif and is found in lipid rafts. It is a part of the complex postsynaptic density fraction in neurons and associates with PSD-95, NMDA receptor and probably other proteins. The intracellular domain of PRR7/TRAP3 contains several tyrosines, a proline-rich sequence, and a C-terminal PDZ-binding motif. So far nothing is known about function of this protein. It may be involved in regulation of some receptor signaling and in formation of neurologic and immunologic synapse.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRR7