Proteinase 3/Myeloblastin/PRTN3 Antibody

Images

 
Western Blot: Proteinase 3/Myeloblastin/PRTN3 Antibody [NBP1-90262] - Analysis in control (vector only transfected HEK293T lysate) and PRTN3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) ...read more
Immunohistochemistry-Paraffin: Proteinase 3/Myeloblastin/PRTN3 Antibody [NBP1-90262] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Proteinase 3/Myeloblastin/PRTN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTQQHFSVAQVFLNNYDAENKLNDILLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRTN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Proteinase 3/Myeloblastin/PRTN3 Protein (NBP1-90262PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteinase 3/Myeloblastin/PRTN3 Antibody

  • ACPA
  • AGP7
  • AGP7PR3
  • azurophil granule protein 7
  • C-ANCA
  • EC 3.4.21
  • EC 3.4.21.76
  • Leukocyte proteinase 3
  • MBN
  • MBT
  • Myeloblastin
  • Neutrophil proteinase 4
  • NP4
  • NP-4
  • P29C-ANCA antigen
  • PR-3CANCA
  • Proteinase 3
  • PRTN3
  • serine proteinase, neutrophil
  • Wegener autoantigen
  • Wegener granulomatosis autoantigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
BPI
7468-BP
Species: Hu
AF2200
Species: Hu
Applications: WB, IP
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3505
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-90262
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262) (0)

There are no publications for Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262) (0)

There are no reviews for Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262). (Showing 1 - 1 of 1 FAQ).

  1. What is the best tissue to be used as a positive control for this antibody?
    • For IHC we recommend using bone marrow as a positive control. For Western blot, we used an overexpression lysate.

Secondary Antibodies

 

Isotype Controls

Additional Proteinase 3/Myeloblastin/PRTN3 Products

Bioinformatics Tool for Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262)

Discover related pathways, diseases and genes to Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262)

Discover more about diseases related to Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262).
 

Pathways for Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262)

View related products by pathway.

Research Areas for Proteinase 3/Myeloblastin/PRTN3 Antibody (NBP1-90262)

Find related products by research area.

Blogs on Proteinase 3/Myeloblastin/PRTN3

There are no specific blogs for Proteinase 3/Myeloblastin/PRTN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteinase 3/Myeloblastin/PRTN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRTN3
Entrez