Protein O-Fucosyltransferase 1/POFUT1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Protein O-Fucosyltransferase 1/POFUT1 Antibody [NBP2-56268] - Staining of human cell line SiHa shows localization to centrosome.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Protein O-Fucosyltransferase 1/POFUT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Protein O-Fucosyltransferase 1/POFUT1 Antibody - BSA Free (NBP2-56268) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSEL
• Predicted Species: Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POFUT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Protein O-Fucosyltransferase 1/POFUT1 Recombinant Protein Antigen (NBP2-56268PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Protein O-Fucosyltransferase 1/POFUT1 Antibody - BSA Free

• FucT-1
• FUT12
• FUT12EC 2.4.1.221
• GDP-fucose protein O-fucosyltransferase 1
• KIAA0180MGC2482
• o-fucosyltransferase protein
• O-Fuc-T
• O-FucT-1
• O-FUT
• Peptide-O-fucosyltransferase 1
• POFUT1
• Protein OFucosyltransferase 1
• Protein O-Fucosyltransferase 1

Background

POFUT1 encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POFUT1