Protein O-Fucosyltransferase 1/POFUT1 Antibody - BSA Free

Western Blot: POFUT1 Antibody [NBP1-69196] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Protein O-Fucosyltransferase 1/POFUT1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to POFUT1 (protein O-fucosyltransferase 1) The peptide sequence was selected form the middle region of POFUT1. Peptide sequence RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POFUT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Protein O-Fucosyltransferase 1/POFUT1 Antibody - BSA Free

• FucT-1
• FUT12
• FUT12EC 2.4.1.221
• GDP-fucose protein O-fucosyltransferase 1
• KIAA0180MGC2482
• o-fucosyltransferase protein
• O-Fuc-T
• O-FucT-1
• O-FUT
• Peptide-O-fucosyltransferase 1
• POFUT1
• Protein OFucosyltransferase 1
• Protein O-Fucosyltransferase 1

Background

This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POFUT1
• OMIM:
  • NP_056167(Human)
• Uniprot:
  • Q6EV69(Human)