Protein Kinase D2 Antibody

Images

 
Western Blot: Protein Kinase D2 Antibody [NBP1-84139] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139] - Staining of human tonsil shows strong positivity in germinal and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protein Kinase D2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QTWLDLRELEGKMGERYITHESDDARWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Protein Kinase D2 Protein (NBP1-84139PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Protein Kinase D2 Antibody

  • DKFZP586E0820
  • EC 2.7.11
  • EC 2.7.11.13
  • nPKC-D2
  • PKD2
  • PKD2HSPC187
  • PRKD2
  • protein kinase D2
  • serine/threonine-protein kinase D2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
BC110-60480
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP1-87948
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84139
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Protein Kinase D2 Antibody (NBP1-84139) (0)

There are no publications for Protein Kinase D2 Antibody (NBP1-84139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Kinase D2 Antibody (NBP1-84139) (0)

There are no reviews for Protein Kinase D2 Antibody (NBP1-84139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protein Kinase D2 Antibody (NBP1-84139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protein Kinase D2 Products

Bioinformatics Tool for Protein Kinase D2 Antibody (NBP1-84139)

Discover related pathways, diseases and genes to Protein Kinase D2 Antibody (NBP1-84139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein Kinase D2 Antibody (NBP1-84139)

Discover more about diseases related to Protein Kinase D2 Antibody (NBP1-84139).
 

Pathways for Protein Kinase D2 Antibody (NBP1-84139)

View related products by pathway.

PTMs for Protein Kinase D2 Antibody (NBP1-84139)

Learn more about PTMs related to Protein Kinase D2 Antibody (NBP1-84139).

Blogs on Protein Kinase D2

There are no specific blogs for Protein Kinase D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protein Kinase D2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKD2
Entrez