Protein Kinase D2 Antibody


Western Blot: Protein Kinase D2 Antibody [NBP1-84139] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA more
Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139] - Staining in human appendix and cerebral cortex tissues using anti-PRKD2 antibody. Corresponding PRKD2 RNA-seq data are presented for the same more
Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139] - Staining of human tonsil shows strong positivity in germinal and non-germinal center cells.
Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: Protein Kinase D2 Antibody [NBP1-84139] - Staining of human cerebral cortex shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Protein Kinase D2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QTWLDLRELEGKMGERYITHESDDARWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL
Specificity of human Protein Kinase D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Protein Kinase D2 Protein (NBP1-84139PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Protein Kinase D2 Antibody

  • DKFZP586E0820
  • EC 2.7.11
  • EC
  • nPKC-D2
  • PKD2
  • PKD2HSPC187
  • PRKD2
  • protein kinase D2
  • serine/threonine-protein kinase D2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, IP, ICC
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Protein Kinase D2 Antibody (NBP1-84139) (0)

There are no publications for Protein Kinase D2 Antibody (NBP1-84139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Kinase D2 Antibody (NBP1-84139) (0)

There are no reviews for Protein Kinase D2 Antibody (NBP1-84139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Protein Kinase D2 Antibody (NBP1-84139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Protein Kinase D2 Products

Bioinformatics Tool for Protein Kinase D2 Antibody (NBP1-84139)

Discover related pathways, diseases and genes to Protein Kinase D2 Antibody (NBP1-84139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protein Kinase D2 Antibody (NBP1-84139)

Discover more about diseases related to Protein Kinase D2 Antibody (NBP1-84139).

Pathways for Protein Kinase D2 Antibody (NBP1-84139)

View related products by pathway.

PTMs for Protein Kinase D2 Antibody (NBP1-84139)

Learn more about PTMs related to Protein Kinase D2 Antibody (NBP1-84139).

Blogs on Protein Kinase D2

There are no specific blogs for Protein Kinase D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Protein Kinase D2 Antibody and receive a gift card or discount.


Gene Symbol PRKD2